CNDP1 (Myc-DDK-tagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNDP1 (Myc-DDK-tagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CNDP1 (GFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CNDP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 422~451 amino acids from the C-terminal region of human CNDP1 |
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CNDP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CNDP1 MS Standard C13 and N15-labeled recombinant protein (NP_116038)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CNDP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA |
CNDP1 (27-507, His-tag) human protein, 0.25 mg
Tag | His-tag |
Expression Host | Insect |
CNDP1 (27-507, His-tag) human protein, 50 µg
Tag | His-tag |
Expression Host | Insect |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression lysate of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CNDP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CNDP1 |
CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CNDP1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
CNDP1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of CNDP1 (NM_032649) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
Tag | C-His |
Expression Host | HEK293 |
Transient overexpression of CNDP1 (NM_032649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNDP1 (NM_032649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack