Germany
Japan
United Kingdom
China
CNDP1 (Myc-DDK-tagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CNDP1 (GFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CNDP1 (Myc-DDK tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CNDP1 (mGFP-tagged) - Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CNDP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC322071 is the updated version of SC125389.
CNDP1 MS Standard C13 and N15-labeled recombinant protein (NP_116038)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CNDP1 (untagged)-Human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA |
CNDP1 (27-507, His-tag) human protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
CNDP1 (27-507, His-tag) human protein, 50 µg
| Tag | His-tag |
| Expression Host | Insect |
Carrier-free (BSA/glycerol-free) CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression lysate of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNDP1 |
USD 420.00
4 Weeks
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CNDP1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Transient overexpression of CNDP1 (NM_032649) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CNDP1 (NM_032649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNDP1 (NM_032649) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CNDP1
Families
- Protease
Pathways
- beta-Alanine metabolism