Products

View as table Download

Rabbit Polyclonal USP10 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen USP10 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human USP10.

Rabbit Polyclonal Anti-USP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP10 antibody: synthetic peptide directed towards the middle region of human USP10. Synthetic peptide located within the following region: GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSK

Carrier-free (BSA/glycerol-free) USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Monkey
Conjugation Biotin

USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Monkey
Conjugation HRP

USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated