Products

cDNA Clones (20)
Proteins (8)
Antibodies (1)
Jump to Filters
View as table Download
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone
RC203884

USD 420.00

In Stock

FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone
RG203884

USD 460.00

In Stock

FAM108A1 (GFP-tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone
RC203884L3

USD 620.00

3 Weeks

Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone Lentiviral Particle
RC203884L3V

USD 820.00

6 Weeks

Lenti ORF particles, ABHD17A (Myc-DDK tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone
RC203884L4

USD 620.00

3 Weeks

Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone Lentiviral Particle
RC203884L4V

USD 820.00

6 Weeks

Lenti ORF particles, ABHD17A (mGFP-tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_001130111) Human Tagged ORF Clone
RC225436

USD 420.00

3 Weeks

FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FAM108A1 (ABHD17A) (NM_001130111) Human Tagged ORF Clone
RC225436L3

USD 620.00

3 Weeks

Lenti-ORF clone of FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_001130111) Human Tagged ORF Clone Lentiviral Particle
RC225436L3V

USD 820.00

6 Weeks

Lenti ORF particles, FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_001130111) Human Tagged ORF Clone
RC225436L4

USD 620.00

3 Weeks

Lenti-ORF clone of FAM108A1 (mGFP-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_001130111) Human Tagged ORF Clone Lentiviral Particle
RC225436L4V

USD 820.00

6 Weeks

Lenti ORF particles, FAM108A1 (mGFP-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FAM108A1 (ABHD17A) (NM_001130111) Human Tagged ORF Clone
RG225436

USD 460.00

3 Weeks

FAM108A1 (GFP-tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone
RC203884L1

USD 768.00

In Stock

Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FAM108A1 (ABHD17A) (NM_031213) Human Over-expression Lysate
LY403109

USD 396.00

In Stock

Transient overexpression lysate of family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody
TA331704

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABHD17A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM108A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM108A1. Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI
FAM108A1 (ABHD17A) (NM_031213) Human Tagged ORF Clone
RC203884L2

USD 620.00

3 Weeks

Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FAM108A1 (ABHD17A) (NM_031213) Human Untagged Clone
SC108680

USD 760.00

In Stock

FAM108A1 (untagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
FAM108A1 (ABHD17A) (NM_031213) Human Untagged Clone
SC125431

USD 320.00

In Stock

FAM108A1 (untagged)-ORIGENE UNIQUE VARIANT 1 of Human family with sequence similarity 108, member A1 (FAM108A1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
FAM108A1 (ABHD17A) (NM_031213) Human Untagged Clone
SC323744

USD 760.00

In Stock

FAM108A1 (untagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
FAM108A1 (ABHD17A) (NM_031213) Human Recombinant Protein
TP761900

USD 215.00

In Stock

Purified recombinant protein of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
FAM108A1 (ABHD17A) (NM_031213) Human Over-expression Lysate
LC403109

USD 121.00

2 Weeks

ABHD17A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FAM108A1 (ABHD17A) (NM_001130111) Human Untagged Clone
SC324923

USD 660.00

3 Weeks

FAM108A1 (untagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
FAM108A1 (ABHD17A) (NM_031213) ICC Control Block
TB403884

USD 1,070.00

4 Weeks

Transient overexpression of ABHD17A (NM_031213) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FAM108A1 (ABHD17A) (NM_001130111) ICC Control Block
TB425436

USD 1,070.00

4 Weeks

Transient overexpression of ABHD17A (NM_001130111) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FAM108A1 (ABHD17A) Cytosection
TS403884

USD 225.00

4 Weeks

Transient overexpression of ABHD17A (NM_031213) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FAM108A1 (ABHD17A) Cytosection
TS403884P5

USD 889.00

4 Weeks

Transient overexpression of ABHD17A (NM_031213) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FAM108A1 (ABHD17A) ICC Control Sections
TS425436P5

USD 889.00

4 Weeks

Transient overexpression of ABHD17A (NM_001130111) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack