Germany
Japan
United Kingdom
China
PSMA2 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, PSMA2 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PSMA2 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PSMA2 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMA2 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMA2 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PSMA2 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal antibody to Proteasome 20S alpha 2 (proteasome (prosome, macropain) subunit, alpha type, 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 2 (Uniprot ID#P25787) |
PSMA2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal Anti-PSMA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA2 antibody: synthetic peptide directed towards the N terminal of human PSMA2. Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV |
PSMA2 (1-234, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PSMA2 (1-234, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 420.00
5 Days
Active filters
Target Symbol
- PSMA2
Families
- Protease