Germany
Japan
United Kingdom
China
USP13 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, USP13 (Myc-DDK tagged) - Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, USP13 (mGFP-tagged) - Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USP13 (GFP-tagged) - Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, USP13 (Myc-DDK tagged) - Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, USP13 (mGFP-tagged) - Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USP13 (untagged)-Human ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC117705 is the updated version of SC125392.
USP13 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of ubiquitin specific peptidase 13 (isopeptidase T-3) (USP13)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-USP13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP13 antibody: synthetic peptide directed towards the N terminal of human USP13. Synthetic peptide located within the following region: TIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK |
USP13 MS Standard C13 and N15-labeled recombinant protein (NP_003931)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of USP13 (NM_003940) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP13 (NM_003940) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of USP13 (NM_003940) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- USP13
Families
- Protease