Products

cDNA Clones (24)
Proteins (16)
Antibodies (3)
Jump to Filters
View as table Download
USP39 (NM_006590) Human Tagged ORF Clone Lentiviral Particle
RC209551L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, USP39 (mGFP-tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP39 (NM_006590) Human Tagged ORF Clone
RC209551

USD 420.00

In Stock

USP39 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 39 (USP39)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
USP39 (NM_006590) Human Tagged ORF Clone Lentiviral Particle
RC209551L1V

USD 820.00

3 Weeks

Lenti ORF particles, USP39 (Myc-DDK tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
USP39 (NM_006590) Human Tagged ORF Clone Lentiviral Particle
RC209551L2V

USD 820.00

6 Weeks

Lenti ORF particles, USP39 (mGFP-tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
USP39 (NM_001256725) Human Tagged ORF Clone
RC234447

USD 420.00

In Stock

USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_006590) Human Tagged ORF Clone
RG209551

USD 460.00

In Stock

USP39 (GFP-tagged) - Human ubiquitin specific peptidase 39 (USP39)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_006590) Human Tagged ORF Clone
RC209551L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP39 (NM_006590) Human Tagged ORF Clone Lentiviral Particle
RC209551L3V

USD 820.00

5 Weeks

Lenti ORF particles, USP39 (Myc-DDK tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP39 (NM_006590) Human Tagged ORF Clone
RC209551L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP39 (NM_001256728) Human Tagged ORF Clone
RC232793

USD 420.00

3 Weeks

USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_001256727) Human Tagged ORF Clone
RC232837

USD 420.00

3 Weeks

USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_001256726) Human Tagged ORF Clone
RC234257

USD 420.00

5 Weeks

USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_001256728) Human Tagged ORF Clone
RG232793

USD 460.00

3 Weeks

USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_001256727) Human Tagged ORF Clone
RG232837

USD 460.00

3 Weeks

USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_001256726) Human Tagged ORF Clone
RG234257

USD 460.00

5 Weeks

USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_001256725) Human Tagged ORF Clone
RG234447

USD 460.00

3 Weeks

USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP39 (NM_006590) Human Tagged ORF Clone
RC209551L1

USD 768.00

In Stock

Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
USP39 Rabbit Polyclonal Antibody
TA343624

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-USP39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP39 antibody: synthetic peptide directed towards the N terminal of human USP39. Synthetic peptide located within the following region: MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRV
USP39 (NM_006590) Human Untagged Clone
SC115970

USD 310.00

In Stock

USP39 (untagged)-Human ubiquitin specific peptidase 39 (USP39)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
USP39 (NM_006590) Human Untagged Clone
SC321985

USD 310.00

In Stock

USP39 (untagged)-Human ubiquitin specific peptidase 39 (USP39)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
USP39 Rabbit Polyclonal Antibody
TA343625

USD 475.00

5 Days

Rabbit Polyclonal Anti-USP39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-USP39 antibody is: synthetic peptide directed towards the C-terminal region of Human USP39. Synthetic peptide located within the following region: YRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQ
USP39 (NM_006590) Human Over-expression Lysate
LY401972

USD 396.00

In Stock

Transient overexpression lysate of ubiquitin specific peptidase 39 (USP39)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
USP39 (NM_006590) Human Tagged ORF Clone
RC209551L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
USP39 (NM_006590) Human Over-expression Lysate
LC401972

USD 121.00

In Stock

USP39 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
USP39 (NM_006590) Human Mass Spec Standard
PH309551

USD 2,055.00

3 Weeks

USP39 MS Standard C13 and N15-labeled recombinant protein (NP_006581)

Tag C-Myc/DDK
Expression Host HEK293
USP39 (NM_001256727) Human Untagged Clone
SC330507

USD 490.00

3 Weeks

USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 4

Vector pCMV6 series
Tag Tag Free
USP39 (NM_001256728) Human Untagged Clone
SC330508

USD 470.00

3 Weeks

USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 5

Vector pCMV6 series
Tag Tag Free
USP39 (NM_001256725) Human Untagged Clone
SC332452

USD 580.00

5 Weeks

USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 2

Vector pCMV6 series
Tag Tag Free
USP39 (NM_001256726) Human Untagged Clone
SC332453

USD 490.00

5 Weeks

USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 3

Vector pCMV6 series
Tag Tag Free
USP39 Rabbit Polyclonal Antibody
TA350587

USD 345.00

In Stock

Rabbit Polyclonal Anti-USP39 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human USP39
USP39 (NM_006590) ICC Control Block
TB409551

USD 1,070.00

4 Weeks

Transient overexpression of USP39 (NM_006590) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP39 (NM_001256728) ICC Control Block
TB432793

USD 1,070.00

4 Weeks

Transient overexpression of USP39 (NM_001256728) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP39 (NM_001256727) ICC Control Block
TB432837

USD 1,070.00

4 Weeks

Transient overexpression of USP39 (NM_001256727) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP39 (NM_001256726) ICC Control Block
TB434257

USD 1,070.00

4 Weeks

Transient overexpression of USP39 (NM_001256726) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP39 (NM_001256725) ICC Control Block
TB434447

USD 1,070.00

4 Weeks

Transient overexpression of USP39 (NM_001256725) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP39 Cytosection
TS409551

USD 225.00

4 Weeks

Transient overexpression of USP39 (NM_006590) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USP39 Cytosection
TS409551P5

USD 889.00

4 Weeks

Transient overexpression of USP39 (NM_006590) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USP39 ICC Control Sections
TS432793P5

USD 889.00

4 Weeks

Transient overexpression of USP39 (NM_001256728) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USP39 ICC Control Sections
TS432837P5

USD 889.00

4 Weeks

Transient overexpression of USP39 (NM_001256727) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USP39 ICC Control Sections
TS434257P5

USD 889.00

4 Weeks

Transient overexpression of USP39 (NM_001256726) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USP39 Cytosection
TS434447

USD 225.00

4 Weeks

Transient overexpression of USP39 (NM_001256725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USP39 Cytosection
TS434447P5

USD 889.00

4 Weeks

Transient overexpression of USP39 (NM_001256725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack