Products

Proteins (18)
cDNA Clones (18)
Antibodies (14)
Jump to Filters
View as table Download
CAMK1D (NM_153498) Human Tagged ORF Clone
RC207736

USD 420.00

In Stock

CAMK1D (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CAMK1D (NM_020397) Human Tagged ORF Clone
RC217129

USD 420.00

In Stock

CAMK1D (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CAMK1D (NM_153498) Human Tagged ORF Clone Lentiviral Particle
RC207736L1V

USD 820.00

3 Weeks

Lenti ORF particles, CAMK1D (Myc-DDK tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CAMK1D (NM_153498) Human Tagged ORF Clone Lentiviral Particle
RC207736L2V

USD 820.00

6 Weeks

Lenti ORF particles, CAMK1D (mGFP-tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CAMK1D (NM_153498) Human Tagged ORF Clone
RG207736

USD 460.00

In Stock

CAMK1D (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CAMK1D (NM_153498) Human Tagged ORF Clone
RC207736L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D (NM_153498) Human Tagged ORF Clone Lentiviral Particle
RC207736L3V

USD 820.00

5 Weeks

Lenti ORF particles, CAMK1D (Myc-DDK tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D (NM_153498) Human Tagged ORF Clone Lentiviral Particle
RC207736L4V

USD 820.00

3 Weeks

Lenti ORF particles, CAMK1D (mGFP-tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D (NM_020397) Human Tagged ORF Clone
RC217129L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D (NM_020397) Human Tagged ORF Clone Lentiviral Particle
RC217129L3V

USD 820.00

6 Weeks

Lenti ORF particles, CAMK1D (Myc-DDK tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D (NM_020397) Human Tagged ORF Clone
RC217129L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D (NM_020397) Human Tagged ORF Clone Lentiviral Particle
RC217129L4V

USD 820.00

6 Weeks

Lenti ORF particles, CAMK1D (mGFP-tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D (NM_020397) Human Tagged ORF Clone
RG217129

USD 460.00

3 Weeks

CAMK1D (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CAMK1D (NM_153498) Human Tagged Lenti ORF Clone
RC207736L4

USD 768.00

In Stock

Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAMK1D Rabbit Polyclonal Antibody
TA309027

USD 415.00

5 Days

Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85)
CAMK1D (NM_153498) Human Tagged ORF Clone
RC207736L1

USD 768.00

In Stock

Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CAMK1D (NM_153498) Human Untagged Clone
SC100851

USD 310.00

In Stock

CAMK1D (untagged)-Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CAMK1D Rabbit Polyclonal Antibody
TA344784

USD 475.00

5 Days

Rabbit Polyclonal Anti-CAMK1D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAMK1D antibody: synthetic peptide directed towards the middle region of human CAMK1D. Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
CAMK1D Rabbit Polyclonal Antibody
TA344785

USD 475.00

5 Days

Rabbit Polyclonal Anti-CAMK1D Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Camk1d antibody is: synthetic peptide directed towards the N-terminal region of Mouse Camk1d. Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY
CAMK1D (1-96) Mouse Monoclonal Antibody [Clone ID: 3H8]
AM31897PU-N

USD 480.00

2 Weeks

CAMK1D (1-96) mouse monoclonal antibody, clone 3H8, Purified

Applications ELISA, IHC, WB
Reactivities Human
CAMK1D (NM_153498) Human Tagged ORF Clone
RC207736L2

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CAMK1D Goat Polyclonal Antibody
TA305711

USD 375.00

In Stock

Goat Anti-CAMK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ASQKDCAYVAKPES, from the C Terminus of the protein sequence according to NP_065130.1.
CAMK1D Rabbit Polyclonal Antibody
TA309025

USD 415.00

5 Days

Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 205 of CaMK1D (Uniprot ID#Q8IU85)
CAMK1D Rabbit Polyclonal Antibody
TA309026

USD 415.00

5 Days

Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 81 and 385 of CAMK1D (Uniprot ID#Q8IU85)
CAMK1D (NM_153498) Human Over-expression Lysate
LC407015

USD 121.00

In Stock

CAMK1D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAMK1D (NM_020397) Human Over-expression Lysate
LC412500

USD 121.00

In Stock

CAMK1D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAMK1D (NM_020397) Human Over-expression Lysate
LC429619

USD 121.00

In Stock

CAMK1D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAMK1D (NM_020397) Human Untagged Clone
SC313112

USD 610.00

In Stock

CAMK1D (untagged)-Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CAMK1D (N-term) Rabbit Polyclonal Antibody
AP17173PU-N

USD 450.00

2 Weeks

CAMK1D (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CAMK1D
CAMK1D (NM_153498) Human Over-expression Lysate
LY407015

USD 396.00

5 Days

Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAMK1D Mouse Monoclonal Antibody [Clone ID: OTI2C6]
CF500919

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CAMK1D (NM_020397) Human Over-expression Lysate
LY412500

USD 396.00

5 Days

Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY412500 is the same product as LY429619.
CAMK1D (NM_020397) Human Over-expression Lysate
LY429619

USD 396.00

5 Days

Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAMK1D (NM_153498) Human Mass Spec Standard
PH307736

USD 2,055.00

3 Weeks

CAMK1D MS Standard C13 and N15-labeled recombinant protein (NP_705718)

Tag C-Myc/DDK
Expression Host HEK293
CAMK1D Rabbit Polyclonal Antibody
TA349737

USD 345.00

In Stock

Rabbit Polyclonal Anti-CAMK1D Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAMK1D
CAMK1D Mouse Monoclonal Antibody [Clone ID: OTI2C6]
TA500919

USD 379.00

In Stock

Anti-CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CAMK1D Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C6]
TA500919BM

USD 420.00

4 Weeks

Anti-CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
CAMK1D Mouse Monoclonal Antibody [Clone ID: OTI2C6]
TA500919S

USD 159.00

2 Days

Anti-CAMK1D mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CAMK1D (NM_153498) ICC Control Block
TB407736

USD 1,070.00

4 Weeks

Transient overexpression of CAMK1D (NM_153498) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CAMK1D (NM_020397) ICC Control Block
TB417129

USD 1,070.00

4 Weeks

Transient overexpression of CAMK1D (NM_020397) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CAMK1D (NM_153498) Human Recombinant Protein
TP721028

USD 330.00

3 Weeks

Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Tag N-GST
Expression Host E. coli
CAMK1D (NM_153498) Human Recombinant Protein
TP721028L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Tag N-GST
Expression Host E. coli
CAMK1D (NM_153498) Human Recombinant Protein
TP721028M

USD 760.00

3 Weeks

Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Tag N-GST
Expression Host E. coli
CAMK1D (NM_153498) Human Recombinant Protein
TP721028XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2

Tag N-GST
Expression Host E. coli
CAMK1D Cytosection
TS407736

USD 225.00

4 Weeks

Transient overexpression of CAMK1D (NM_153498) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CAMK1D Cytosection
TS407736P5

USD 889.00

4 Weeks

Transient overexpression of CAMK1D (NM_153498) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CAMK1D Cytosection
TS417129

USD 225.00

4 Weeks

Transient overexpression of CAMK1D (NM_020397) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CAMK1D Cytosection
TS417129P5

USD 889.00

4 Weeks

Transient overexpression of CAMK1D (NM_020397) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack