EPHB3 (Myc-DDK-tagged)-Human EPH receptor B3 (EPHB3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPHB3 (Myc-DDK-tagged)-Human EPH receptor B3 (EPHB3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPHB3 (GFP-tagged) - Human EPH receptor B3 (EPHB3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, EPHB3 (Myc-DDK tagged) - Human EPH receptor B3 (EPHB3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, EPHB3 (mGFP-tagged) - Human EPH receptor B3 (EPHB3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human EPH receptor B3 (EPHB3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
EPHB3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens EPH receptor B3, Signal peptide (1-33) plus EC domain (34-559)
Vector | pCMV6-XL5-DDK-His |
Tag | DDK-His |
Mammalian Cell Selection | None |
Lenti ORF clone of Human EPH receptor B3 (EPHB3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, EPHB3 (Myc-DDK tagged) - Human EPH receptor B3 (EPHB3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, EPHB3 (mGFP-tagged) - Human EPH receptor B3 (EPHB3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EPHB3 (untagged)-Human EPH receptor B3 (EPHB3)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human EPH receptor B3 (EPHB3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of EPH receptor B3 (EPHB3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of human EPH receptor B3 (EPHB3), with C-terminal DDK/His tag, expressed in human cells, 20 µg
Tag | C-DDK/His |
Expression Host | HEK293 |
EPHB3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Purified recombinant protein of Human EPH receptor B3 (EPHB3), residues 34-559aa, with C-terminal DDK tag, expressed in sf9, 20ug
Tag | C-DDK |
Expression Host | Sf9 |
Rabbit Polyclonal Anti-EPHB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPHB3 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHB3. Synthetic peptide located within the following region: QLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYI |
EPHB3 MS Standard C13 and N15-labeled recombinant protein (NP_004434)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-EPHB3 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EPHB3 |
Transient overexpression of EPHB3 (NM_004443) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EPHB3 (NM_004443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPHB3 (NM_004443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack