MAP3K2 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAP3K2 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, MAP3K2 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, MAP3K2 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MAP3K2 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, MAP3K2 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, MAP3K2 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAP3K2 (untagged)-Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MAP3K2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAP3K2 |
MAP3K2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Anti-MAP3K2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2. Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE |
MAP3K2 MS Standard C13 and N15-labeled recombinant protein (NP_006600)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack