Germany
Japan
United Kingdom
China
MAP3K2 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, MAP3K2 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, MAP3K2 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Map3k2 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAP3K2 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAP3K2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN423988 is the updated version of KN223988.
Map3k2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509734 is the updated version of KN309734.
Map3k2 (GFP-tagged) - Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Map3k2 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Map3k2 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Map3k2 (mGFP-tagged) - Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Map3k2 (GFP-tagged) - Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, MAP3K2 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, MAP3K2 (mGFP-tagged) - Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Map3k2 (myc-DDK-tagged) - Rat mitogen activated protein kinase kinase kinase 2 (Map3k2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAP3K2 (untagged)-Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human mitogen-activated protein kinase kinase kinase 2 (MAP3K2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MAP3K2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 2 (MAP3K2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAP3K2 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
MAP3K2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Rabbit polyclonal Anti-MAP3K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2. Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE |
MAP3K2 CRISPRa kit - CRISPR gene activation of human mitogen-activated protein kinase kinase kinase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Map3k2 CRISPRa kit - CRISPR gene activation of mouse mitogen-activated protein kinase kinase kinase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene MAP3K2
Map3k2 (untagged) - Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Map3k2
MAP3K2 MS Standard C13 and N15-labeled recombinant protein (NP_006600)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Map3k2 (untagged) - Rat mitogen activated protein kinase kinase kinase 2 (Map3k2)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Map3k2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MEKK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human MEKK2 (NP_006600.3). |
| Modifications | Unmodified |
MEKK2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human MEKK2 |
MEKK2 Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded controls for ICC/IHC staining
MAP3K2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
MAP3K2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Map3k2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Map3k2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse mitogen-activated protein kinase kinase kinase 2 (Map3k2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Map3k2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP3K2 (NM_006609) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MAP3K2