Germany
Japan
United Kingdom
China
CXCL14 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CXCL14 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CXCL14 (untagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of chemokine (C-X-C motif) ligand 14 (CXCL14)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14 / BRAK)
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CXCL14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE |
Rabbit Polyclonal Anti-CXCL14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
CXCL14 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression of CXCL14 (NM_004887) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of CXCL14 (NM_004887) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CXCL14 (NM_004887) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CXCL14
Families
- Secreted Protein
Pathways
- Chemokine signaling pathway