Germany
Japan
United Kingdom
China
A1BG (Myc-DDK-tagged)-Human alpha-1-B glycoprotein (A1BG)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human alpha-1-B glycoprotein (A1BG), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, A1BG (Myc-DDK tagged) - Human alpha-1-B glycoprotein (A1BG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human alpha-1-B glycoprotein (A1BG), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, A1BG (mGFP-tagged) - Human alpha-1-B glycoprotein (A1BG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
A1BG (GFP-tagged) - Human alpha-1-B glycoprotein (A1BG)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
A1BG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Anti-A1BG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 150-164 amino acids of human alpha-1-B glycoprotein |
Transient overexpression lysate of alpha-1-B glycoprotein (A1BG)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
A1BG (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 232~262 amino acids from the Central region of human A1BG. |
Rabbit polyclonal anti-A1BG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human A1BG. |
Rabbit Polyclonal Anti-A1BG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A1BG antibody: synthetic peptide directed towards the N terminal of human A1BG. Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG |
Rabbit Polyclonal Anti-A1BG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A1BG antibody: synthetic peptide directed towards the C terminal of human A1BG. Synthetic peptide located within the following region: REGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELS |
A1BG MS Standard C13 and N15-labeled recombinant protein (NP_570602)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
A1BG (untagged)-Human alpha-1-B glycoprotein (A1BG)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-A1BG Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 150-164 amino acids of human alpha-1-B glycoprotein |
Transient overexpression of A1BG (NM_130786) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of A1BG (NM_130786) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of A1BG (NM_130786) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- A1BG
Families
- Secreted Protein