Germany
Japan
United Kingdom
China
CPB1 (Myc-DDK-tagged)-Human carboxypeptidase B1 (tissue) (CPB1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CPB1 (GFP-tagged) - Human carboxypeptidase B1 (tissue) (CPB1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human carboxypeptidase B1 (tissue) (CPB1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CPB1 (Myc-DDK tagged) - Human carboxypeptidase B1 (tissue) (CPB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human carboxypeptidase B1 (tissue) (CPB1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CPB1 (mGFP-tagged) - Human carboxypeptidase B1 (tissue) (CPB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal CPB1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CPB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 9-37 amino acids from the N-terminal region of human CPB1. |
Transient overexpression lysate of carboxypeptidase B1 (tissue) (CPB1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CPB1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CPB1 (untagged)-Human carboxypeptidase B1 (tissue) (CPB1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC118994 is the updated version of SC126526.
Rabbit Polyclonal Anti-CPB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPB1 antibody: synthetic peptide directed towards the N terminal of human CPB1. Synthetic peptide located within the following region: SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL |
CPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001862)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-CPB1 Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CPB1 |
Transient overexpression of CPB1 (NM_001871) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CPB1 (NM_001871) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CPB1 (NM_001871) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CPB1
Families
- Secreted Protein