CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CTF1 (mGFP-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTF1 (mGFP-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CTF1 (mGFP-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTF1 (mGFP-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CTF1 (GFP-tagged) - Human cardiotrophin 1 (CTF1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTF1 (GFP-tagged) - Human cardiotrophin 1 (CTF1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTF1 (untagged)-Human cardiotrophin 1 (CTF1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1.
Tag | Tag Free |
Expression Host | E. coli |
Cardiotrophin 1 (CTF1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-Human Cardiotrophin-1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Cardiotrophin-1 |
Cardiotrophin 1 (CTF1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 165-194 amino acids from the C-terminal region of Human CTF1. |
Biotinylated Anti-Human Cardiotrophin-1 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Cardiotrophin-1 |
Rabbit Polyclonal Anti-CTF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTF1 antibody: synthetic peptide directed towards the N terminal of human CTF1. Synthetic peptide located within the following region: MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ |
Rabbit Polyclonal Anti-CTF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTF1 antibody: synthetic peptide directed towards the N terminal of human CTF1. Synthetic peptide located within the following region: HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG |
Cardiotrophin-1 (His-tagged) human protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression of CTF1 (NM_001330) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CTF1 (NM_001142544) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human cardiotrophin 1 (CTF1), transcript variant 1
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of CTF1 (NM_001330) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CTF1 (NM_001330) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CTF1 (NM_001142544) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack