Cardiotrophin 1 (CTF1) Rabbit Polyclonal Antibody

CAT#: TA340013

Rabbit Polyclonal Anti-CTF1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CTF1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CTF1 antibody: synthetic peptide directed towards the N terminal of human CTF1. Synthetic peptide located within the following region: HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 21 kDa
Gene Name cardiotrophin 1
Background CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.
Synonyms CT-1; CT1
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.