Germany
Japan
United Kingdom
China
TFF1 (Myc-DDK-tagged)-Human trefoil factor 1 (TFF1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Purified recombinant protein of Human trefoil factor 1 (TFF1).
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF particles, TFF1 (Myc-DDK tagged) - Human trefoil factor 1 (TFF1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TFF1 (mGFP-tagged) - Human trefoil factor 1 (TFF1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Purified recombinant protein of Homo sapiens trefoil factor 1 (TFF1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TFF1 (GFP-tagged) - Human trefoil factor 1 (TFF1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, TFF1 (Myc-DDK tagged) - Human trefoil factor 1 (TFF1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human trefoil factor 1 (TFF1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TFF1 (mGFP-tagged) - Human trefoil factor 1 (TFF1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human trefoil factor 1 (TFF1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human trefoil factor 1 (TFF1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TFF1 (untagged)-Human trefoil factor 1 (TFF1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TFF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human trefoil factor 1 (TFF1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of trefoil factor 1 (TFF1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-TFF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human TFF-1 |
Rabbit Polyclonal Anti-TFF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFF1 antibody: synthetic peptide directed towards the middle region of human TFF1. Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
Trefoil factor 1 / pS2 (25-84, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
Trefoil factor 1 / pS2 (25-84, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
TFF1 MS Standard C13 and N15-labeled recombinant protein (NP_003216)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-TFF1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-84 amino acids of human trefoil factor 1 |
USD 420.00
4 Weeks
Transient overexpression of TFF1 (NM_003225) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TFF1 (NM_003225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- TFF1
Families
- Secreted Protein