CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human cell division cycle 2, G1 to S and G2 to M (CDC2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human tubulin, alpha 3c (TUBA3C), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CDK1 (GFP-tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDK1 (Myc-DDK tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, CDK1 (mGFP-tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TUBA3C (GFP-tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDK1 (GFP-tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cyclin-dependent kinase 1 (CDK1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (Myc-DDK tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cyclin-dependent kinase 1 (CDK1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (mGFP-tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tubulin, alpha 3c (TUBA3C), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 840.00
6 Weeks
Lenti ORF particles, TUBA3C (Myc-DDK tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tubulin, alpha 3c (TUBA3C), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 840.00
6 Weeks
Lenti ORF particles, TUBA3C (mGFP-tagged) - Human tubulin, alpha 3c (TUBA3C), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDK1 (mGFP-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (mGFP-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TUBA3C (Myc-DDK-tagged)-Human tubulin, alpha 3c (TUBA3C), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TUBA3C (mGFP-tagged)-Human tubulin, alpha 3c (TUBA3C)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TUBA3C (mGFP-tagged)-Human tubulin, alpha 3c (TUBA3C), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDK1 (mGFP-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (mGFP-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 5
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CDK1 (mGFP-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 5
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDK1 (mGFP-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TUBA3C (GFP-tagged) - Human tubulin, alpha 3c (TUBA3C)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDK1 (GFP-tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDK1 (GFP-tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDK1 (untagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-UVRAG Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG. |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Lenti ORF clone of Human cyclin-dependent kinase 1 (CDK1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CDK1 (untagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 2
Vector | PCMV6-Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
TUBA3D mouse monoclonal antibody, clone 3F10-2F2
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal CDC2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC2. |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |