Germany
Japan
United Kingdom
China
AATF (Myc-DDK-tagged)-Human apoptosis antagonizing transcription factor (AATF)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, AATF (Myc-DDK tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, AATF (mGFP-tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
AATF (GFP-tagged) - Human apoptosis antagonizing transcription factor (AATF)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AATF (Myc-DDK tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AATF (mGFP-tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
AATF (untagged)-Human apoptosis antagonizing transcription factor (AATF)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-AATF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF |
Rabbit Polyclonal Anti-AATF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the C terminal of human AATF. Synthetic peptide located within the following region: PNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPI |
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
AATF (untagged)-Human apoptosis antagonizing transcription factor (AATF)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-AATF antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human AATF. |
AATF HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal anti-AATF antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE |
Transient overexpression lysate of apoptosis antagonizing transcription factor (AATF)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-AATF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AATF |
Transient overexpression of AATF (NM_012138) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human apoptosis antagonizing transcription factor (AATF), full length, with C-terminal DDK tag, expressed in sf9, 20ug
| Tag | C-DDK |
| Expression Host | Sf9 |
Transient overexpression of AATF (NM_012138) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AATF (NM_012138) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- AATF
Families
- Stem cell - Pluripotency