AATF (Myc-DDK-tagged)-Human apoptosis antagonizing transcription factor (AATF)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AATF (Myc-DDK-tagged)-Human apoptosis antagonizing transcription factor (AATF)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, AATF (Myc-DDK tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, AATF (mGFP-tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Aatf (Myc-DDK-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AATF (GFP-tagged) - Human apoptosis antagonizing transcription factor (AATF)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AATF - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Aatf - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Aatf (GFP-tagged) - Mouse apoptosis antagonizing transcription factor (cDNA clone MGC:35916 IMAGE:2648117)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Aatf (Myc-DDK-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Aatf (Myc-DDK-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Aatf (mGFP-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Aatf (GFP-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AATF (Myc-DDK tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AATF (mGFP-tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Aatf (Myc-DDK-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Aatf (Myc-DDK-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Aatf (Myc-DDK-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Aatf (mGFP-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Aatf (GFP-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
AATF (untagged)-Human apoptosis antagonizing transcription factor (AATF)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-AATF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF |
Rabbit Polyclonal Anti-AATF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the C terminal of human AATF. Synthetic peptide located within the following region: PNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPI |
Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
AATF (untagged)-Human apoptosis antagonizing transcription factor (AATF)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Aatf (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal AATF Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | AATF antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human AATF. |
Rabbit polyclonal anti-AATF antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human AATF. |
AATF HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Aatf (untagged) - Mouse apoptosis antagonizing transcription factor (Aatf), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal anti-AATF antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE |
AATF - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
AATF CRISPRa kit - CRISPR gene activation of human apoptosis antagonizing transcription factor
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Aatf CRISPRa kit - CRISPR gene activation of mouse apoptosis antagonizing transcription factor
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene AATF
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene AATF
Transient overexpression lysate of apoptosis antagonizing transcription factor (AATF)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Aatf
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Aatf
Aatf (untagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of apoptosis antagonizing transcription factor (AATF) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
AATF (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Aatf (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-AATF Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AATF |
Transient overexpression of AATF (NM_012138) in HEK293T cells paraffin embedded controls for ICC/IHC staining
AATF - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Aatf - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Aatf - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |