Products

View as table Download

USD 98.00

USD 560.00

In Stock

AATF (Myc-DDK-tagged)-Human apoptosis antagonizing transcription factor (AATF)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, AATF (Myc-DDK tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, AATF (mGFP-tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Aatf (Myc-DDK-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

AATF (GFP-tagged) - Human apoptosis antagonizing transcription factor (AATF)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AATF - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400070 is the updated version of KN200070.

Aatf - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN500594 is the updated version of KN300594.

Aatf (GFP-tagged) - Mouse apoptosis antagonizing transcription factor (cDNA clone MGC:35916 IMAGE:2648117)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Aatf (Myc-DDK-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Aatf (Myc-DDK-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Aatf (mGFP-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Aatf (GFP-tagged) - Mouse apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AATF (Myc-DDK tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AATF (mGFP-tagged) - Human apoptosis antagonizing transcription factor (AATF), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Aatf (Myc-DDK-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Aatf (Myc-DDK-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Aatf (Myc-DDK-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Aatf (mGFP-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Aatf (GFP-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

AATF (untagged)-Human apoptosis antagonizing transcription factor (AATF)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-AATF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF

Rabbit Polyclonal Anti-AATF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AATF antibody: synthetic peptide directed towards the C terminal of human AATF. Synthetic peptide located within the following region: PNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPI

Lenti ORF clone of Human apoptosis antagonizing transcription factor (AATF), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

AATF (untagged)-Human apoptosis antagonizing transcription factor (AATF)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Aatf (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Rabbit Polyclonal AATF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen AATF antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human AATF.

Rabbit polyclonal anti-AATF antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human AATF.

AATF HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Aatf (untagged) - Mouse apoptosis antagonizing transcription factor (Aatf), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal anti-AATF antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE

AATF - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

AATF CRISPRa kit - CRISPR gene activation of human apoptosis antagonizing transcription factor

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Aatf CRISPRa kit - CRISPR gene activation of mouse apoptosis antagonizing transcription factor

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene AATF

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene AATF

qPCR primer pairs and template standards against Mus musculus gene Aatf

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Aatf

Aatf (untagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of apoptosis antagonizing transcription factor (AATF) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

AATF (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Aatf (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Rabbit Polyclonal Anti-AATF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AATF

Transient overexpression of AATF (NM_012138) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AATF - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Aatf - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Aatf - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti