Germany
Japan
United Kingdom
China
STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
STAT6 (untagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
STAT6 (GFP-tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, STAT6 (Myc-DDK tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, STAT6 (mGFP-tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
STAT6 (GFP-tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (Myc-DDK tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, STAT6 (mGFP-tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 5
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 5
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, STAT6 (mGFP-tagged)-Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
STAT6 (GFP-tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STAT6 (GFP-tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STAT6 (GFP-tagged) - Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-STAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STAT6 |
Transient overexpression lysate of signal transducer and activator of transcription 6, interleukin-4 induced (STAT6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
STAT6 (untagged)-Human signal transducer and activator of transcription 6 interleukin-4 induced (STAT6) transcript variant 4
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal STAT6 (Tyr641) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 around the phosphorylation site of Tyrosine 641 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 |
STAT6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit anti-STAT6 (Phospho-Tyr641) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal STAT6 phospho Y641 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | STAT6 phospho Y641 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y641 of human STAT6 protein. |
Rabbit Polyclonal STAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 |
Rabbit Polyclonal STAT6 (Thr645) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT6 around the phosphorylation site of Threonine 645 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-STAT6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
Rabbit anti-STAT6 (Phospho-Thr645) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K). |
| Modifications | Phospho-specific |
Active filters
Target Symbol
- STAT6
Families
- Stem cell relevant signaling - JAK/STAT signaling pathway