Rabbit Polyclonal NSD3 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a internal portion of the human protein (within residues 300-400). [Swiss-Prot# Q9BZ95] |
Rabbit Polyclonal NSD3 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a internal portion of the human protein (within residues 300-400). [Swiss-Prot# Q9BZ95] |
Rabbit anti-WHSC1L1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human WHSC1L1 |
Goat Polyclonal Antibody against SETMAR
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RWQKCVDCNGSYFD, from the C Terminus of the protein sequence according to NP_006506. |
Rabbit polyclonal anti-SETMAR antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SETMAR. |
Rabbit Polyclonal Anti-WHSC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG |
Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI1F11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI6A12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI3G3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI3B3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
WHSC1L1 mouse monoclonal antibody,clone OTI1F11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI1F11, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI1F11, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
WHSC1L1 mouse monoclonal antibody,clone OTI1F11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
WHSC1L1 mouse monoclonal antibody,clone OTI6A12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI6A12, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI6A12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
WHSC1L1 mouse monoclonal antibody,clone OTI6A12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
WHSC1L1 mouse monoclonal antibody,clone OTI3G3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI3G3, Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI3G3, HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
WHSC1L1 mouse monoclonal antibody,clone OTI3G3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
WHSC1L1 mouse monoclonal antibody,clone OTI3B3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI3B3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
WHSC1L1 mouse monoclonal antibody,clone OTI3B3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
WHSC1L1 mouse monoclonal antibody,clone OTI3B3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |