SRF (Myc-DDK-tagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SRF (Myc-DDK-tagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SRF (GFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 880.00
3 Weeks
Lenti ORF particles, SRF (Myc-DDK tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, SRF (mGFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SRF (untagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
7 Weeks
Lenti ORF particles, SRF (Myc-DDK tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
7 Weeks
Lenti ORF particles, SRF (mGFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SRF (myc-DDK-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of serum response factor (c-fos serum response element-binding transcription factor) (SRF)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Anti-SRF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QASPSRDSSTDLTQ, from the internal region of the protein sequence according to NP_003122.1. |
Rabbit polyclonal SRF (Ab-99) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SRF around the phosphorylation site of serine 99 (S-L-S-E-M). |
Rabbit polyclonal SRF (Ser77) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SRF around the phosphorylation site of serine 77 (L-Y-SP-G-S). |
Modifications | Phospho-specific |
Anti-SRF rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 495-508 amino acids of human serum response factor (c-fos serum response element-binding transcription factor) |
Rabbit Polyclonal Anti-SRF Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRF Antibody: A synthesized peptide derived from human SRF |
Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal SRF Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF |
Rabbit Polyclonal SRF (Ser99) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF around the phosphorylation site of Serine 99 |
Modifications | Phospho-specific |
Serum Response Factor (SRF) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 61-110 of Human SRF. |
SRF HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-SRF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF. Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM |
SRF MS Standard C13 and N15-labeled recombinant protein (NP_003122)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SRF (GFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SRF (untagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of SRF (NM_003131) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SRF (NM_001292001) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SRF (NM_003131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SRF (NM_003131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SRF (NM_001292001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack