Germany
Japan
United Kingdom
China
SRF (Myc-DDK-tagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SRF (GFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 880.00
3 Weeks
Lenti ORF particles, SRF (Myc-DDK tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 880.00
6 Weeks
Lenti ORF particles, SRF (mGFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SRF (untagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
7 Weeks
Lenti ORF particles, SRF (Myc-DDK tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
7 Weeks
Lenti ORF particles, SRF (mGFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SRF (myc-DDK-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of serum response factor (c-fos serum response element-binding transcription factor) (SRF)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-SRF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QASPSRDSSTDLTQ, from the internal region of the protein sequence according to NP_003122.1. |
Rabbit polyclonal SRF (Ser77) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SRF around the phosphorylation site of serine 77 (L-Y-SP-G-S). |
| Modifications | Phospho-specific |
Anti-SRF rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 495-508 amino acids of human serum response factor (c-fos serum response element-binding transcription factor) |
Rabbit Polyclonal Anti-SRF Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRF Antibody: A synthesized peptide derived from human SRF |
Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal SRF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF |
Rabbit Polyclonal SRF (Ser99) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF around the phosphorylation site of Serine 99 |
| Modifications | Phospho-specific |
SRF HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-SRF Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF. Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM |
SRF MS Standard C13 and N15-labeled recombinant protein (NP_003122)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SRF (GFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SRF (untagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of SRF (NM_003131) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SRF (NM_001292001) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SRF (NM_003131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SRF (NM_003131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SRF (NM_001292001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SRF
Families
- Transcription Factors
Pathways
- MAPK signaling pathway