Germany
Japan
United Kingdom
China
BTG2 (Myc-DDK-tagged)-Human BTG family, member 2 (BTG2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, BTG2 (Myc-DDK tagged) - Human BTG family, member 2 (BTG2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, BTG2 (mGFP-tagged) - Human BTG family, member 2 (BTG2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
BTG2 (GFP-tagged) - Human BTG family, member 2 (BTG2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BTG2 (untagged)-Human BTG family, member 2 (BTG2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, BTG2 (Myc-DDK tagged) - Human BTG family, member 2 (BTG2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, BTG2 (mGFP-tagged) - Human BTG family, member 2 (BTG2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human BTG family, member 2 (BTG2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of BTG family, member 2 (BTG2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human BTG family, member 2 (BTG2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human BTG family, member 2 (BTG2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit anti-BTG2 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Recombinant protein of human BTG family, member 2 (BTG2), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
BTG2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human BTG family, member 2 (BTG2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-BTG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the N terminal of human BTG2. Synthetic peptide located within the following region: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY |
Rabbit Polyclonal Anti-BTG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the middle region of human BTG2. Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTG2 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI7A10 (formerly 7A10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BTG2 mouse monoclonal antibody, clone OTI9D3 (formerly 9D3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BTG2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Active filters
Target Symbol
- BTG2
Families
- Transcription Factors