Germany
Japan
United Kingdom
China
CTCF (Myc-DDK-tagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CTCF (untagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CTCF (GFP-tagged) - Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CTCF (Myc-DDK tagged) - Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CTCF (mGFP-tagged) - Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CTCF (Myc-DDK tagged) - Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CTCF (mGFP-tagged) - Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CTCF (Myc-DDK-tagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CTCF (Myc-DDK-tagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CTCF (Myc-DDK-tagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CTCF (mGFP-tagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CTCF (mGFP-tagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CTCF (GFP-tagged) - Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CTCF (untagged)-Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression lysate of CCCTC-binding factor (zinc finger protein) (CTCF)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CTCF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV |
CTCF HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CTCF Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE |
Rabbit polyclonal anti-CTCF (Boris) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 14 of rat BORIS |
Rabbit polyclonal anti-CTCF antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CTCF affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of CTCF protein. |
Transient overexpression of CTCF (NM_006565) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CTCF (NM_001191022) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human CCCTC-binding factor (zinc finger protein) (CTCF), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of CTCF (NM_006565) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CTCF (NM_006565) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CTCF (NM_001191022) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CTCF
Families
- Transcription Factors