Products

cDNA Clones (11)
Proteins (6)
Antibodies (3)
Jump to Filters
View as table Download
FMNL2 (NM_052905) Human Tagged ORF Clone
RC219109

USD 1,150.00

In Stock

FMNL2 (Myc-DDK-tagged)-Human formin-like 2 (FMNL2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FMNL2 (NM_052905) Human Tagged ORF Clone
RC219109L3

USD 1,350.00

3 Weeks

Lenti ORF clone of Human formin-like 2 (FMNL2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FMNL2 (NM_052905) Human Tagged ORF Clone
RC219109L4

USD 1,350.00

3 Weeks

Lenti ORF clone of Human formin-like 2 (FMNL2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FMNL2 (NM_052905) Human Tagged ORF Clone
RG219109

USD 1,260.00

3 Weeks

FMNL2 (GFP-tagged) - Human formin-like 2 (FMNL2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FMNL2 (NM_052905) Human Tagged ORF Clone
RC219109L2

USD 1,350.00

3 Weeks

Lenti ORF clone of Human formin-like 2 (FMNL2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FMNL2 Rabbit Polyclonal Antibody
TA337055

USD 402.00

5 Days

Rabbit Polyclonal FMNL2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 1-50 of human Formin-like protein 2 was used as the immunogen.
FMNL2 Rabbit Polyclonal Antibody
TA337941

USD 375.00

5 Days

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody is: synthetic peptide directed towards the middle region of Human FMNL2. Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ
FMNL2 Rabbit Polyclonal Antibody
TA342487

USD 375.00

5 Days

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2. Synthetic peptide located within the following region: MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKAR
FMNL2 (NM_052905) Human Over-expression Lysate
LC409402

USD 187.00

2 Weeks

FMNL2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FMNL2 (NM_052905) Human Over-expression Lysate
LY409402

USD 605.00

5 Days

Transient overexpression lysate of formin-like 2 (FMNL2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FMNL2 (NM_052905) Human Mass Spec Standard
PH319109

USD 2,055.00

3 Weeks

FMNL2 MS Standard C13 and N15-labeled recombinant protein (NP_443137)

Tag C-Myc/DDK
Expression Host HEK293
FMNL2 (NM_052905) Human Untagged Clone
SC315171

USD 1,100.00

3 Weeks

FMNL2 (untagged)-Human formin-like 2 (FMNL2)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FMNL2 (NM_052905) ICC Control Block
TB419109

USD 1,800.00

4 Weeks

Transient overexpression of FMNL2 (NM_052905) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FMNL2 Cytosection
TS419109

USD 225.00

4 Weeks

Transient overexpression of FMNL2 (NM_052905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FMNL2 Cytosection
TS419109P5

USD 889.00

4 Weeks

Transient overexpression of FMNL2 (NM_052905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack