FMNL2 (Myc-DDK-tagged)-Human formin-like 2 (FMNL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FMNL2 (Myc-DDK-tagged)-Human formin-like 2 (FMNL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, FMNL2 (Myc-DDK tagged) - Human formin-like 2 (FMNL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, FMNL2 (mGFP-tagged) - Human formin-like 2 (FMNL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Fmnl2 (Myc-DDK-tagged) - Mouse formin-like 2 (Fmnl2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FMNL2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Fmnl2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Fmnl2 (GFP-tagged) - Mouse formin-like 2 (Fmnl2), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Fmnl2 (Myc-DDK-tagged) - Mouse formin-like 2 (Fmnl2)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Fmnl2 (Myc-DDK-tagged) - Mouse formin-like 2 (Fmnl2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Fmnl2 (mGFP-tagged) - Mouse formin-like 2 (Fmnl2)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Fmnl2 (GFP-tagged) - Mouse formin-like 2 (Fmnl2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human formin-like 2 (FMNL2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, FMNL2 (Myc-DDK tagged) - Human formin-like 2 (FMNL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human formin-like 2 (FMNL2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, FMNL2 (mGFP-tagged) - Human formin-like 2 (FMNL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FMNL2 (GFP-tagged) - Human formin-like 2 (FMNL2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human formin-like 2 (FMNL2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human formin-like 2 (FMNL2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal FMNL2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 1-50 of human Formin-like protein 2 was used as the immunogen. |
Rabbit Polyclonal Anti-FMNL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMNL2 antibody is: synthetic peptide directed towards the middle region of Human FMNL2. Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ |
Rabbit Polyclonal Anti-FMNL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2. Synthetic peptide located within the following region: MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKAR |
FMNL2 CRISPRa kit - CRISPR gene activation of human formin like 2
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Fmnl2 CRISPRa kit - CRISPR gene activation of mouse formin-like 2
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene FMNL2
FMNL2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of formin-like 2 (FMNL2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Fmnl2 (untagged) - Mouse formin-like 2 (Fmnl2), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Fmnl2
FMNL2 MS Standard C13 and N15-labeled recombinant protein (NP_443137)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
3`UTR clone of formin-like 2 (FMNL2) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
FMNL2 (untagged)-Human formin-like 2 (FMNL2)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
FMNL2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Fmnl2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
FMNL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FMNL2 |
FMNL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FMNL2 |
Transient overexpression of FMNL2 (NM_052905) in HEK293T cells paraffin embedded controls for ICC/IHC staining
FMNL2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
FMNL2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Fmnl2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Fmnl2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse formin-like 2 (Fmnl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Tag | C-MYC/DDK |
Expression Host | HEK293T |
FMNL2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Fmnl2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of FMNL2 (NM_052905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FMNL2 (NM_052905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack