HEXIM2 (Myc-DDK-tagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (Myc-DDK-tagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human hexamthylene bis-acetamide inducible 2 (HEXIM2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, HEXIM2 (Myc-DDK tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, HEXIM2 (mGFP-tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HEXIM2 (Myc-DDK tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HEXIM2 (mGFP-tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 10
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-HEXIM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HEXIM2 antibody: synthetic peptide directed towards the N terminal of human HEXIM2. Synthetic peptide located within the following region: MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES |
Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
HEXIM2 (untagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of hexamthylene bis-acetamide inducible 2 (HEXIM2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HEXIM2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HEXIM2 MS Standard C13 and N15-labeled recombinant protein (NP_653209)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 9
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 10
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 6
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 7
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 8
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 9
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 10
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of HEXIM2 (NM_144608) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HEXIM2 (NM_001303437) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HEXIM2 (NM_001303438) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HEXIM2 (NM_001303439) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HEXIM2 (NM_001303440) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HEXIM2 (NM_001303441) in HEK293T cells paraffin embedded controls for ICC/IHC staining