Products

View as table Download

HEXIM2 (Myc-DDK-tagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, HEXIM2 (Myc-DDK tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, HEXIM2 (mGFP-tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HEXIM2 (Myc-DDK tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HEXIM2 (mGFP-tagged) - Human hexamthylene bis-acetamide inducible 2 (HEXIM2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

HEXIM2 (myc-DDK-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 10

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-HEXIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXIM2 antibody: synthetic peptide directed towards the N terminal of human HEXIM2. Synthetic peptide located within the following region: MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES

Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human hexamthylene bis-acetamide inducible 2 (HEXIM2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

HEXIM2 (untagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression lysate of hexamthylene bis-acetamide inducible 2 (HEXIM2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

HEXIM2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

HEXIM2 MS Standard C13 and N15-labeled recombinant protein (NP_653209)

Tag C-Myc/DDK
Expression Host HEK293

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (GFP-tagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 10

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HEXIM2 (untagged)-Human hexamthylene bis-acetamide inducible 2 (HEXIM2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 7

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 8

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 9

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

HEXIM2 (untagged) - Human hexamethylene bis-acetamide inducible 2 (HEXIM2), transcript variant 10

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of HEXIM2 (NM_144608) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HEXIM2 (NM_001303437) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HEXIM2 (NM_001303438) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HEXIM2 (NM_001303439) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HEXIM2 (NM_001303440) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HEXIM2 (NM_001303441) in HEK293T cells paraffin embedded controls for ICC/IHC staining