Germany
Japan
United Kingdom
China
PITX2 (Myc-DDK-tagged)-Human paired-like homeodomain 2 (PITX2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PITX2 (Myc-DDK-tagged)-Human paired-like homeodomain 2 (PITX2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PITX2 (Myc-DDK-tagged)-Human paired-like homeodomain 2 (PITX2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PITX2 (mGFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, PITX2 (Myc-DDK tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PITX2 (mGFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, PITX2 (Myc-DDK tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PITX2 (mGFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PITX2 (GFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PITX2 (GFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PITX2 (Myc-DDK tagged) - Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PITX2 (Myc-DDK tagged) - Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PITX2 (Myc-DDK tagged) - Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PITX2 (GFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PITX2 (Myc-DDK tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PITX2 (mGFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PITX2 (Myc-DDK tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PITX2 (mGFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PITX2 (Myc-DDK tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PITX2 (mGFP-tagged) - Human paired-like homeodomain 2 (PITX2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PITX2 (GFP-tagged) - Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PITX2 (GFP-tagged) - Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PITX2 (GFP-tagged) - Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PITX2 (untagged)-Human paired-like homeodomain 2 (PITX2), transcript variant 3
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human paired-like homeodomain 2 (PITX2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human paired-like homeodomain 2 (PITX2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human paired-like homeodomain 2 (PITX2), transcript variant 3, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human paired-like homeodomain 2 (PITX2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PITX2 (untagged)-Human paired-like homeodomain 2 (PITX2), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal PITX2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
PITX2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of paired-like homeodomain 2 (PITX2), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE |
Purified recombinant protein of Human paired-like homeodomain 2 (PITX2), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASS |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: EFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQ |
Carrier-free (BSA/glycerol-free) PITX2 mouse monoclonal antibody,clone OTI1H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PITX2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PITX2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Active filters
Target Symbol
- PITX2
Families
- Transcription Factors