Products

View as table Download

SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SF1 (GFP-tagged) - Human splicing factor 1 (SF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SF1 (GFP-tagged) - Human splicing factor 1 (SF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SF1 (GFP-tagged) - Human splicing factor 1 (SF1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, SF1 (Myc-DDK tagged) - Human splicing factor 1 (SF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SF1 (Myc-DDK tagged) - Human splicing factor 1 (SF1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

SF1 (GFP-tagged) - Human splicing factor 1 (SF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SF1 (GFP-tagged) - Human splicing factor 1 (SF1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SF1 (GFP-tagged) - Human splicing factor 1 (SF1), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-SF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF1 antibody: synthetic peptide directed towards the N terminal of human SF1. Synthetic peptide located within the following region: NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ

Rabbit polyclonal SF1 (Ab-82) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human SF1 around the phosphorylation site of serine 82 (S-P-SP-P-E).

Rabbit polyclonal SF1 (Ser82) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SF1 around the phosphorylation site of serine 82 (S-P-SP-P-E).
Modifications Phospho-specific

SF1 (untagged)-Human splicing factor 1 (SF1), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF1 antibody: synthetic peptide directed towards the C terminal of human SF1. Synthetic peptide located within the following region: MASSTPLPWQQNTTTTTTSAGTGSIPPWQQQQAAAAASPGAPQMQGNPTM

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF1 antibody: synthetic peptide directed towards the C terminal of human SF1. Synthetic peptide located within the following region: APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW

SF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SF1 (untagged)-Human splicing factor 1 (SF1), transcript variant 4

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SF1 Antibody: synthetic peptide directed towards the N terminal of human SF1. Synthetic peptide located within the following region: LRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLIT

Rabbit Polyclonal Anti-SF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SF1 Antibody: synthetic peptide directed towards the middle region of human SF1. Synthetic peptide located within the following region: VKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRP