Products

cDNA Clones (47)
Proteins (22)
Antibodies (4)
Jump to Filters
View as table Download
FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone
RC221759

USD 420.00

In Stock

SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FUSIP1 (SRSF10) (NM_054016) Human Tagged ORF Clone
RC214037

USD 98.00

USD 390.00

In Stock

SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191009) Human Tagged ORF Clone
RC231007

USD 420.00

In Stock

SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone
RG221759

USD 460.00

In Stock

SRSF10 (GFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_054016) Human Tagged ORF Clone
RC214037L3

USD 620.00

3 Weeks

Lenti-ORF clone of SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_054016) Human Tagged ORF Clone Lentiviral Particle
RC214037L3V

USD 820.00

5 Weeks

Lenti ORF particles, SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_054016) Human Tagged ORF Clone
RC214037L4

USD 620.00

3 Weeks

Lenti-ORF clone of SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_054016) Human Tagged ORF Clone Lentiviral Particle
RC214037L4V

USD 820.00

11 Weeks

Lenti ORF particles, SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone
RC221759L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Lentiviral Particle
RC221759L3V

USD 820.00

6 Weeks

Lenti ORF particles, SRSF10 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone
RC221759L4

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Lentiviral Particle
RC221759L4V

USD 820.00

6 Weeks

Lenti ORF particles, SRSF10 (mGFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191006) Human Tagged ORF Clone
RC230767

USD 420.00

2 Weeks

SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191006) Human Tagged ORF Clone
RC230767L3

USD 620.00

8 Weeks

Lenti-ORF clone of SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191006) Human Tagged ORF Clone Lentiviral Particle
RC230767L3V

USD 820.00

11 Weeks

Lenti ORF particles, SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191006) Human Tagged ORF Clone
RC230767L4

USD 620.00

8 Weeks

Lenti-ORF clone of SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191006) Human Tagged ORF Clone Lentiviral Particle
RC230767L4V

USD 820.00

11 Weeks

Lenti ORF particles, SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191007) Human Tagged ORF Clone
RC230771

USD 420.00

2 Weeks

SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191007) Human Tagged ORF Clone
RC230771L3

USD 620.00

8 Weeks

Lenti-ORF clone of SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191007) Human Tagged ORF Clone Lentiviral Particle
RC230771L3V

USD 820.00

11 Weeks

Lenti ORF particles, SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191007) Human Tagged ORF Clone
RC230771L4

USD 620.00

8 Weeks

Lenti-ORF clone of SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191007) Human Tagged ORF Clone Lentiviral Particle
RC230771L4V

USD 820.00

11 Weeks

Lenti ORF particles, SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191005) Human Tagged ORF Clone
RC230790

USD 420.00

3 Weeks

SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191005) Human Tagged ORF Clone
RC230790L3

USD 620.00

8 Weeks

Lenti-ORF clone of SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191005) Human Tagged ORF Clone Lentiviral Particle
RC230790L3V

USD 820.00

11 Weeks

Lenti ORF particles, SRSF10 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191005) Human Tagged ORF Clone
RC230790L4

USD 620.00

8 Weeks

Lenti-ORF clone of SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191005) Human Tagged ORF Clone Lentiviral Particle
RC230790L4V

USD 820.00

11 Weeks

Lenti ORF particles, SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191009) Human Tagged ORF Clone
RC231007L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191009) Human Tagged ORF Clone Lentiviral Particle
RC231007L3V

USD 820.00

6 Weeks

Lenti ORF particles, SRSF10 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191009) Human Tagged ORF Clone
RC231007L4

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001191009) Human Tagged ORF Clone Lentiviral Particle
RC231007L4V

USD 820.00

6 Weeks

Lenti ORF particles, SRSF10 (mGFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FUSIP1 (SRSF10) (NM_001300936) Human Tagged ORF Clone
RC236265

USD 420.00

2 Weeks

SRSF10 (myc-DDK-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001300937) Human Tagged ORF Clone
RC236652

USD 420.00

2 Weeks

SRSF10 (myc-DDK-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_054016) Human Tagged ORF Clone
RG214037

USD 460.00

3 Weeks

SRSF10 (GFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191006) Human Tagged ORF Clone
RG230767

USD 460.00

3 Weeks

SRSF10 (GFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191007) Human Tagged ORF Clone
RG230771

USD 460.00

3 Weeks

SRSF10 (GFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191005) Human Tagged ORF Clone
RG230790

USD 460.00

3 Weeks

SRSF10 (GFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) (NM_001191009) Human Tagged ORF Clone
RG231007

USD 460.00

3 Weeks

SRSF10 (GFP-tagged) - Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FUSIP1 (SRSF10) Rabbit Polyclonal Antibody
TA343968

USD 475.00

5 Days

Rabbit Polyclonal Anti-FUSIP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS
FUSIP1 (SRSF10) (NM_054016) Human Untagged Clone
SC124408

USD 310.00

In Stock

SRSF10 (untagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
FUSIP1 (SRSF10) (NM_006625) Human Untagged Clone
SC115990

USD 310.00

In Stock

SRSF10 (untagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
FUSIP1 (SRSF10) Rabbit Polyclonal Antibody
TA343969

USD 475.00

5 Days

Rabbit Polyclonal Anti-FUSIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: KSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEK
FUSIP1 (SRSF10) Rabbit Polyclonal Antibody
TA345979

USD 475.00

5 Days

Rabbit Polyclonal Anti-FUSIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the N terminal of human FUSIP1. Synthetic peptide located within the following region: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP
FUSIP1 (SRSF10) (NM_054016) Human Tagged ORF Clone
RC214037L2

USD 620.00

3 Weeks

Lenti-ORF clone of SRSF10 (mGFP-tagged)-Human serine/arginine-rich splicing factor 10 (SRSF10), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FUSIP1 (SRSF10) Rabbit Polyclonal Antibody
TA309882

USD 410.00

5 Days

Rabbit Polyclonal FUSIP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 100-200). [Swiss-Prot# O75494]
FUSIP1 (SRSF10) (NM_006625) Human Over-expression Lysate
LC416515

USD 121.00

2 Weeks

SRSF10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FUSIP1 (SRSF10) (NM_006625) Human Over-expression Lysate
LY416515

USD 396.00

5 Days

Transient overexpression lysate of splicing factor, arginine/serine-rich 13A (SFRS13A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FUSIP1 (SRSF10) (NM_006625) Human Mass Spec Standard
PH321759

USD 2,055.00

3 Weeks

SFRS13A MS Standard C13 and N15-labeled recombinant protein (NP_006616)

Tag C-Myc/DDK
Expression Host HEK293