Germany
Japan
United Kingdom
China
SUPT16H (Myc-DDK-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
| Vector | pCMV6-AC-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti-ORF clone of SUPT16H (Myc-DDK-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUPT16H (Myc-DDK-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SUPT16H (mGFP-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUPT16H (mGFP-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SUPT16H (GFP-tagged) - Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUPT16H (untagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SUPT16H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the middle region of human SUPT16H. Synthetic peptide located within the following region: EESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR |
Rabbit Polyclonal Anti-SUPT16H Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT16H Antibody: A synthesized peptide derived from human SUPT16H |
Goat Polyclonal Antibody against SUPT16H
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLTNKEGKKPEEK, from the internal region of the protein sequence according to NP_009123.1. |
Rabbit Polyclonal anti-SUPT16H antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the N terminal of human SUPT16H. Synthetic peptide located within the following region: ASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIK |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of SUPT16H (NM_007192) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SUPT16H (NM_007192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SUPT16H (NM_007192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SUPT16H
Families
- Transcription Factors