SUPT16H (Myc-DDK-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
Vector | pCMV6-AC-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
SUPT16H (Myc-DDK-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
Vector | pCMV6-AC-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of SUPT16H (Myc-DDK-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SUPT16H (Myc-DDK-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SUPT16H (mGFP-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SUPT16H (mGFP-tagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SUPT16H (GFP-tagged) - Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SUPT16H (untagged)-Human suppressor of Ty 16 homolog (S. cerevisiae) (SUPT16H)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SUPT16H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the middle region of human SUPT16H. Synthetic peptide located within the following region: EESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR |
Rabbit Polyclonal Anti-SUPT16H Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUPT16H Antibody: A synthesized peptide derived from human SUPT16H |
Goat Polyclonal Antibody against SUPT16H
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DLTNKEGKKPEEK, from the internal region of the protein sequence according to NP_009123.1. |
Rabbit Polyclonal anti-SUPT16H antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the N terminal of human SUPT16H. Synthetic peptide located within the following region: ASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIK |
Carrier-free (BSA/glycerol-free) SUPT16H mouse monoclonal antibody,clone OTI3B8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SUPT16H mouse monoclonal antibody,clone OTI8A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SUPT16H mouse monoclonal antibody,clone OTI3B8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SUPT16H mouse monoclonal antibody,clone OTI3B8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SUPT16H mouse monoclonal antibody,clone OTI3B8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SUPT16H mouse monoclonal antibody,clone OTI3B8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SUPT16H mouse monoclonal antibody,clone OTI8A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SUPT16H mouse monoclonal antibody,clone OTI8A1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SUPT16H mouse monoclonal antibody,clone OTI8A1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SUPT16H mouse monoclonal antibody,clone OTI8A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of SUPT16H (NM_007192) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SUPT16H (NM_007192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SUPT16H (NM_007192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack