Products

cDNA Clones (72)
Proteins (38)
Antibodies (5)
Jump to Filters
View as table Download
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone
RC212828

USD 1,250.00

In Stock

ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_012408) Human Tagged ORF Clone
RC221394

USD 1,220.00

In Stock

ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone
RG212828

USD 1,380.00

2 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone
RC212828L3

USD 1,450.00

3 Weeks

Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone Lentiviral Particle
RC212828L3V

USD 1,650.00

6 Weeks

Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone
RC212828L4

USD 1,450.00

3 Weeks

Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone Lentiviral Particle
RC212828L4V

USD 1,650.00

6 Weeks

Lenti ORF particles, ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183048) Human Tagged ORF Clone
RC215969

USD 1,190.00

5 Weeks

ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_183048) Human Tagged ORF Clone
RC215969L3

USD 1,390.00

5 Weeks

Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183048) Human Tagged ORF Clone Lentiviral Particle
RC215969L3V

USD 1,590.00

8 Weeks

Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183048) Human Tagged ORF Clone
RC215969L4

USD 1,390.00

5 Weeks

Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183048) Human Tagged ORF Clone Lentiviral Particle
RC215969L4V

USD 1,590.00

8 Weeks

Lenti ORF particles, ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_012408) Human Tagged ORF Clone
RC221394L3

USD 1,420.00

3 Weeks

Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_012408) Human Tagged ORF Clone Lentiviral Particle
RC221394L3V

USD 1,620.00

6 Weeks

Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_012408) Human Tagged ORF Clone
RC221394L4

USD 1,420.00

3 Weeks

Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_012408) Human Tagged ORF Clone Lentiviral Particle
RC221394L4V

USD 1,620.00

6 Weeks

Lenti ORF particles, ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_001281769) Human Tagged ORF Clone
RC236112

USD 420.00

2 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281780) Human Tagged ORF Clone
RC239745

USD 750.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 14

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281779) Human Tagged ORF Clone
RC239786

USD 750.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 13

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281771) Human Tagged ORF Clone
RC239921

USD 1,110.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281781) Human Tagged ORF Clone
RC239958

USD 1,140.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 15

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281776) Human Tagged ORF Clone
RC239976

USD 1,160.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 10

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281784) Human Tagged ORF Clone
RC239998

USD 1,190.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 18

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281782) Human Tagged ORF Clone
RC240001

USD 1,190.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 16

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281777) Human Tagged ORF Clone
RC240013

USD 1,220.00

4 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 11

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281774) Human Tagged ORF Clone
RC240017

USD 1,230.00

5 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281778) Human Tagged ORF Clone
RC240029

USD 1,240.00

5 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 12

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281772) Human Tagged ORF Clone
RC240032

USD 1,250.00

5 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281783) Human Tagged ORF Clone
RC240044

USD 1,270.00

5 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 17

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281773) Human Tagged ORF Clone
RC240048

USD 1,270.00

5 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281775) Human Tagged ORF Clone
RC240067

USD 1,300.00

5 Weeks

ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_183048) Human Tagged ORF Clone
RG215969

USD 1,310.00

6 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_012408) Human Tagged ORF Clone
RG221394

USD 1,340.00

3 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) Rabbit Polyclonal Antibody
TA347318

USD 358.00

5 Days

Rabbit Polyclonal ZMYND8 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND8 antibody: human ZMYND8 (zinc finger, MYND-type containing 8), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein.
PRKCBP1 (ZMYND8) Rabbit Polyclonal Antibody
TA347629

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKCB1 Antibody: A synthesized peptide derived from human PKCB1
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone
RC212828L1

USD 1,450.00

3 Weeks

Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PRKCBP1 (ZMYND8) (NM_183047) Human Tagged ORF Clone
RC212828L2

USD 1,450.00

3 Weeks

Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PRKCBP1 (ZMYND8) Rabbit Polyclonal Antibody
TA315262

USD 345.00

In Stock

Rabbit polyclonal anti-PKCB1 (PKC Binding Protein 1) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PKCB1.
PRKCBP1 (ZMYND8) (BC001004) Human Untagged Clone
SC106088

USD 660.00

In Stock

(untagged)-Homo sapiens, clone MGC:5439, complete cds

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PRKCBP1 (ZMYND8) (NM_183047) Human Untagged Clone
SC110323

USD 2,400.00

In Stock

ZMYND8 (untagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PRKCBP1 (ZMYND8) (NM_012408) Human Untagged Clone
SC115423

USD 2,350.00

In Stock

ZMYND8 (untagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PRKCBP1 (ZMYND8) Rabbit Polyclonal Antibody
TA337717

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZMYND8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND8 antibody: synthetic peptide directed towards the N terminal of human ZMYND8. Synthetic peptide located within the following region: TAQKRKFPSPPHSSNGHSPQDTSTSPIKKKKKPGLLNSNNKEQSELRHGP
PRKCBP1 (ZMYND8) Rabbit Polyclonal Antibody
TA337718

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZMYND8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZMYND8 antibody: synthetic peptide directed towards the middle region of human ZMYND8. Synthetic peptide located within the following region: SVSKRCDKQPAYAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTR
PRKCBP1 (ZMYND8) (NM_001281769) Human Tagged ORF Clone
RG236112

USD 460.00

2 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281780) Human Tagged ORF Clone
RG239745

USD 790.00

2 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 14

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281779) Human Tagged ORF Clone
RG239786

USD 790.00

2 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 13

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281771) Human Tagged ORF Clone
RG239921

USD 1,150.00

2 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRKCBP1 (ZMYND8) (NM_001281781) Human Tagged ORF Clone
RG239958

USD 1,180.00

2 Weeks

ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 15

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®