USD 1,650.00
6 Weeks
Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
-
USD 1,650.00
6 Weeks
Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,650.00
6 Weeks
Lenti ORF particles, ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,650.00
6 Weeks
Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,650.00
6 Weeks
Lenti ORF particles, ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,590.00
8 Weeks
Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,590.00
8 Weeks
Lenti ORF particles, ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,620.00
6 Weeks
Lenti ORF particles, ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,620.00
6 Weeks
Lenti ORF particles, ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 14
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 13
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 15
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 10
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 18
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 16
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 11
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 12
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 17
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (myc-DDK-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal ZMYND8 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZMYND8 antibody: human ZMYND8 (zinc finger, MYND-type containing 8), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Anti-PKCB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PKCB1 Antibody: A synthesized peptide derived from human PKCB1 |
Lenti-ORF clone of ZMYND8 (Myc-DDK-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of ZMYND8 (mGFP-tagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-PKCB1 (PKC Binding Protein 1) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PKCB1. |
(untagged)-Homo sapiens, clone MGC:5439, complete cds
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ZMYND8 (untagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ZMYND8 (untagged)-Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ZMYND8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZMYND8 antibody: synthetic peptide directed towards the N terminal of human ZMYND8. Synthetic peptide located within the following region: TAQKRKFPSPPHSSNGHSPQDTSTSPIKKKKKPGLLNSNNKEQSELRHGP |
Rabbit Polyclonal Anti-ZMYND8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZMYND8 antibody: synthetic peptide directed towards the middle region of human ZMYND8. Synthetic peptide located within the following region: SVSKRCDKQPAYAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTR |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 14
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 13
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ZMYND8 (GFP-tagged) - Human zinc finger, MYND-type containing 8 (ZMYND8), transcript variant 15
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |