Products

cDNA Clones (4)
Proteins (3)
Antibodies (1)
Jump to Filters
View as table Download
ZNF93 (NM_031218) Human Tagged ORF Clone
RC212079

USD 420.00

In Stock

ZNF93 (Myc-DDK-tagged)-Human zinc finger protein 93 (ZNF93). Note: ORF is codon optimized

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ZNF93 (NM_031218) Human Tagged ORF Clone
RG212079

USD 460.00

3 Weeks

ZNF93 (GFP-tagged) - Human zinc finger protein 93 (ZNF93). Note: ORF is codon optimized

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ZNF93 Rabbit Polyclonal Antibody
TA342481

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF93 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF93 antibody: synthetic peptide directed towards the N terminal of human ZNF93. Synthetic peptide located within the following region: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC
ZNF93 (BC020837) Human Untagged Clone
SC106184

USD 1,180.00

2 Weeks

(untagged)-Homo sapiens, Similar to zinc finger protein 253, clone IMAGE:4809649

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
ZNF93 (NM_031218) Human Untagged Clone
SC314221

USD 760.00

3 Weeks

ZNF93 (untagged)-Human zinc finger protein 93 (ZNF93)

Vector pCMV6 series
Tag Tag Free
ZNF93 (NM_031218) ICC Control Block
TB412079

USD 1,070.00

4 Weeks

Transient overexpression of ZNF93 (NM_031218) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ZNF93 Cytosection
TS412079

USD 225.00

4 Weeks

Transient overexpression of ZNF93 (NM_031218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ZNF93 Cytosection
TS412079P5

USD 889.00

4 Weeks

Transient overexpression of ZNF93 (NM_031218) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack