Products

Antibodies (42)
cDNA Clones (33)
Proteins (20)
Jump to Filters
View as table Download
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320

USD 480.00

In Stock

MAOB (Myc-DDK-tagged)-Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Recombinant Protein
TP300648

USD 867.00

In Stock

Recombinant protein of human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Tagged ORF Clone Lentiviral Particle
RC200648L1V

USD 820.00

3 Weeks

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Tagged ORF Clone Lentiviral Particle
RC223398L1V

USD 850.00

3 Weeks

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RG205320

USD 530.00

In Stock

MAOB (GFP-tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Tagged ORF Clone Lentiviral Particle
RC200648L3V

USD 820.00

5 Weeks

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Tagged ORF Clone Lentiviral Particle
RC200648L4V

USD 820.00

3 Weeks

Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L3

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone Lentiviral Particle
RC205320L3V

USD 880.00

7 Weeks

Lenti ORF particles, MAOB (Myc-DDK tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L4

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone Lentiviral Particle
RC205320L4V

USD 880.00

5 Weeks

Lenti ORF particles, MAOB (mGFP-tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Tagged ORF Clone Lentiviral Particle
RC223398L3V

USD 850.00

3 Weeks

Lenti ORF particles, ALDH3A2 (Myc-DDK tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Tagged ORF Clone Lentiviral Particle
RC223398L4V

USD 850.00

7 Weeks

Lenti ORF particles, ALDH3A2 (mGFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Tagged ORF Clone
RG223398

USD 500.00

3 Weeks

ALDH3A2 (GFP-tagged) - Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Over-expression Lysate
LY400321

USD 396.00

In Stock

Transient overexpression lysate of monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA327079

USD 275.00

2 Weeks

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Tagged ORF Clone
RC223398L1

USD 804.00

In Stock

Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Untagged Clone
SC108847

USD 310.00

In Stock

MAOB (untagged)-Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Tagged Lenti ORF Clone
RC200648L3

USD 768.00

3 Weeks

Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA590756

USD 409.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Untagged Clone
SC119943

USD 820.00

In Stock

ALDH3A2 (untagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Monoamine Oxidase B (MAOB) Goat Polyclonal Antibody
TA318153

USD 425.00

In Stock

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).
Aldehyde dehydrogenase 10 (ALDH3A2) Goat Polyclonal Antibody
TA348940

USD 429.00

5 Days

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L1

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Tagged ORF Clone
RC223398L2

USD 650.00

3 Weeks

Lenti ORF clone of Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Untagged Clone
SC320187

USD 760.00

In Stock

ALDH3A2 (untagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Monoamine Oxidase B (MAOB) (NM_000898) Human Over-expression Lysate
LC400321

USD 121.00

In Stock

MAOB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Over-expression Lysate
LY422196

USD 396.00

In Stock

Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Over-expression Lysate
LY424751

USD 605.00

In Stock

Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY424751 is the same product as LY424995.
Aldehyde dehydrogenase 10 (ALDH3A2) (NM_000382) Human Over-expression Lysate
LY424995

USD 396.00

In Stock

Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA306639

USD 430.00

5 Days

Rabbit Polyclonal Aldh3A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2.
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332354

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332355

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA335228

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG