CCR8 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 8 (CCR8)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CCR8 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 8 (CCR8)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCR8 (GFP-tagged) - Human chemokine (C-C motif) receptor 8 (CCR8)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CCR8 (mGFP-tagged) - Human chemokine (C-C motif) receptor 8 (CCR8), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, CCR8 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 8 (CCR8), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF clone of Human chemokine (C-C motif) receptor 8 (CCR8), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CCR8 (mGFP-tagged) - Human chemokine (C-C motif) receptor 8 (CCR8), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CCR8 (untagged)-Human chemokine (C-C motif) receptor 8 (CCR8)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human chemokine (C-C motif) receptor 8 (CCR8), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human chemokine (C-C motif) receptor 8 (CCR8), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CCR8 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 8 (CCR8), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CCR8 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 297-325 amino acids from the C-terminal region of human CCR8 |
Lenti ORF clone of Human chemokine (C-C motif) receptor 8 (CCR8), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal CCR8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop. |
Rabbit Polyclonal Anti-CCR8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |
Rabbit Polyclonal Anti-CCR8 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR8 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human CCR8. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Elephant, Panda (83%). |
Rabbit anti CCR8 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Immunogen | A synthetic peptide of 170-203aa of human CCR 8. This sequence is identical to human, mouse and rat. |
Rabbit anti CCR8 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CCR8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human chemokine (C-C motif) receptor 8 |
Anti-CCR8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human C-C chemokine receptor type 8 |
Transient overexpression of CCR8 (NM_005201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack