Germany
Japan
United Kingdom
China
EPO (Myc-DDK-tagged)-Human erythropoietin (EPO)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, EPO (Myc-DDK tagged) - Human erythropoietin (EPO), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
EPO (untagged)-Human erythropoietin (EPO)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, EPO (mGFP-tagged) - Human erythropoietin (EPO), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
EPO (GFP-tagged) - Human erythropoietin (EPO)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human erythropoietin (EPO), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, EPO (Myc-DDK tagged) - Human erythropoietin (EPO), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, EPO (mGFP-tagged) - Human erythropoietin (EPO), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human erythropoietin (EPO)
| Tag | Tag Free |
| Expression Host | CHO |
Lenti ORF clone of Human erythropoietin (EPO), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human erythropoietin (EPO), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Erythropoietin / EPO (alpha) human recombinant protein, 50 µg
Erythropoietin / EPO human recombinant protein, 50 µg
| Expression Host | CHO |
Erythropoietin / EPO human recombinant protein, 10 µg
| Expression Host | CHO |
Erythropoietin / EPO (28-193, His-tag) human protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
Erythropoietin / EPO (28-193, His-tag) human protein, 50 µg
| Tag | His-tag |
| Expression Host | Insect |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO Antibody: A synthesized peptide derived from human EPO |
Lenti ORF clone of Human erythropoietin (EPO), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
EPO mouse monoclonal antibody, clone Epo2
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Purified recombinant protein of Human erythropoietin (EPO), Ala28-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Erythropoietin / EPO (28-193, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
Erythropoietin / EPO (28-193, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) EPO mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EPO HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of erythropoietin (EPO)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
EPO mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EPO mouse monoclonal antibody,clone OTI5D8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
EPO mouse monoclonal antibody,clone OTI5D8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
EPO mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of EPO (NM_000799) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EPO (NM_000799) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPO (NM_000799) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- EPO
Families
- Transmembrane
Pathways
- Cytokine-cytokine receptor interaction