MAVS (Myc-DDK-tagged)-Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAVS (Myc-DDK-tagged)-Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human virus-induced signaling adapter (VISA), nuclear gene encoding mitochondrial protein
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
MAVS (GFP-tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MAVS (Myc-DDK tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAVS (mGFP-tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, MAVS (Myc-DDK tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAVS (mGFP-tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAVS (Myc-DDK tagged) - Homo sapiens mitochondrial antiviral signaling protein (MAVS), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAVS (GFP-tagged) - Homo sapiens mitochondrial antiviral signaling protein (MAVS), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal VISA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA. |
Rabbit anti-MAVS Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAVS |
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MAVS (untagged)-Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal VISA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA. |
MAVS HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse Monoclonal MAVS Antibody (58N3B6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
Mouse Monoclonal MAVS Antibody (58N3E1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal MAVS Antibody (58N2B2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS (1-513, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
MAVS (1-513, His-tag) human recombinant protein, 10 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS MS Standard C13 and N15-labeled recombinant protein (NP_065797)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
MAVS (untagged) - Homo sapiens mitochondrial antiviral signaling protein (MAVS), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAVS |
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI9C4 (formerly 9C4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of MAVS (NM_020746) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAVS (NM_001206491) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAVS (NM_020746) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAVS (NM_020746) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAVS (NM_001206491) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack