Products

cDNA Clones (20)
Proteins (14)
Antibodies (4)
Jump to Filters
View as table Download
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone
RC212741

USD 420.00

In Stock

B4GALT2 (Myc-DDK-tagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
B4GALT3 (B4GALT2) (NM_001005417) Human Tagged ORF Clone
RC211753

USD 420.00

In Stock

B4GALT2 (Myc-DDK-tagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone Lentiviral Particle
RC212741L1V

USD 820.00

3 Weeks

Lenti ORF particles, B4GALT2 (Myc-DDK tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone Lentiviral Particle
RC212741L2V

USD 820.00

6 Weeks

Lenti ORF particles, B4GALT2 (mGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone
RG212741

USD 460.00

In Stock

B4GALT2 (GFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (B4GALT2) (NM_001005417) Human Tagged ORF Clone
RC211753L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_001005417) Human Tagged ORF Clone Lentiviral Particle
RC211753L3V

USD 820.00

6 Weeks

Lenti ORF particles, B4GALT2 (Myc-DDK tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_001005417) Human Tagged ORF Clone
RC211753L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_001005417) Human Tagged ORF Clone Lentiviral Particle
RC211753L4V

USD 820.00

6 Weeks

Lenti ORF particles, B4GALT2 (mGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone
RC212741L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone Lentiviral Particle
RC212741L3V

USD 820.00

5 Weeks

Lenti ORF particles, B4GALT2 (Myc-DDK tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone
RC212741L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone Lentiviral Particle
RC212741L4V

USD 820.00

7 Weeks

Lenti ORF particles, B4GALT2 (mGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
B4GALT3 (B4GALT2) (NM_030587) Human Tagged ORF Clone
RC233988

USD 420.00

2 Weeks

B4GALT2 (Myc-DDK tagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (B4GALT2) (NM_001005417) Human Tagged ORF Clone
RG211753

USD 460.00

3 Weeks

B4GALT2 (GFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (B4GALT2) (NM_030587) Human Tagged ORF Clone
RG233988

USD 460.00

5 Weeks

B4GALT2 (GFP-tagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
B4GALT3 (B4GALT2) (NM_003780) Human Tagged ORF Clone
RC212741L2

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
B4GALT3 (B4GALT2) (NM_003780) Human Untagged Clone
SC117761

USD 760.00

In Stock

B4GALT2 (untagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
B4GALT3 (B4GALT2) (C-term) Rabbit Polyclonal Antibody
AP50331PU-N

USD 450.00

2 Weeks

B4GALT3 (B4GALT2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 297~326 amino acids from the C-terminal region of human B4GALT2
B4GALT3 (B4GALT2) (NM_003780) Human Over-expression Lysate
LY418436

USD 396.00

5 Days

Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
B4GALT3 (B4GALT2) Rabbit Polyclonal Antibody
TA336172

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
B4GALT3 (B4GALT2) Rabbit Polyclonal Antibody
TA336173

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD
B4GALT3 (B4GALT2) Rabbit Polyclonal Antibody
TA336174

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR
B4GALT3 (B4GALT2) (NM_003780) Human Over-expression Lysate
LC418436

USD 121.00

2 Weeks

B4GALT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
B4GALT3 (B4GALT2) (NM_001005417) Human Over-expression Lysate
LC423722

USD 121.00

2 Weeks

B4GALT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
B4GALT3 (B4GALT2) (NM_001005417) Human Over-expression Lysate
LC425140

USD 121.00

2 Weeks

B4GALT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
B4GALT3 (B4GALT2) (NM_001005417) Human Over-expression Lysate
LY423722

USD 396.00

5 Days

Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY423722 is the same product as LY425140.
B4GALT3 (B4GALT2) (NM_001005417) Human Over-expression Lysate
LY425140

USD 396.00

5 Days

Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
B4GALT3 (B4GALT2) (NM_001005417) Human Untagged Clone
SC300951

USD 760.00

3 Weeks

B4GALT2 (untagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
B4GALT3 (B4GALT2) (NM_030587) Human Untagged Clone
SC333296

USD 400.00

5 Weeks

B4GALT2 (untagged) - Homo sapiens UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4GALT2), transcript variant 1

Vector pCMV6 series
Tag Tag Free
B4GALT3 (B4GALT2) (NM_001005417) ICC Control Block
TB411753

USD 1,070.00

4 Weeks

Transient overexpression of B4GALT2 (NM_001005417) in HEK293T cells paraffin embedded controls for ICC/IHC staining

B4GALT3 (B4GALT2) (NM_003780) ICC Control Block
TB412741

USD 1,070.00

4 Weeks

Transient overexpression of B4GALT2 (NM_003780) in HEK293T cells paraffin embedded controls for ICC/IHC staining

B4GALT3 (B4GALT2) (NM_030587) ICC Control Block
TB433988

USD 1,070.00

4 Weeks

Transient overexpression of B4GALT2 (NM_030587) in HEK293T cells paraffin embedded controls for ICC/IHC staining

B4GALT3 (B4GALT2) Cytosection
TS411753

USD 225.00

4 Weeks

Transient overexpression of B4GALT2 (NM_001005417) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

B4GALT3 (B4GALT2) Cytosection
TS411753P5

USD 889.00

4 Weeks

Transient overexpression of B4GALT2 (NM_001005417) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

B4GALT3 (B4GALT2) Cytosection
TS412741

USD 225.00

4 Weeks

Transient overexpression of B4GALT2 (NM_003780) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

B4GALT3 (B4GALT2) Cytosection
TS412741P5

USD 889.00

4 Weeks

Transient overexpression of B4GALT2 (NM_003780) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

B4GALT3 (B4GALT2) ICC Control Sections
TS433988P5

USD 889.00

4 Weeks

Transient overexpression of B4GALT2 (NM_030587) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack