Products

cDNA Clones (49)
Proteins (35)
Antibodies (13)
Jump to Filters
View as table Download
VAP1 (AOC3) (NM_003734) Human Tagged ORF Clone
RC208516

USD 420.00

In Stock

AOC3 (Myc-DDK-tagged)-Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320

USD 480.00

In Stock

MAOB (Myc-DDK-tagged)-Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AOC2 (NM_009590) Human Tagged ORF Clone
RC222991

USD 420.00

In Stock

AOC2 (Myc-DDK-tagged)-Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AOC2 (NM_001158) Human Tagged ORF Clone
RC217318

USD 810.00

In Stock

AOC2 (Myc-DDK-tagged)-Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VAP1 (AOC3) (NM_003734) Human Tagged ORF Clone Lentiviral Particle
RC208516L1V

USD 820.00

2 Weeks

Lenti ORF particles, AOC3 (Myc-DDK tagged) - Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
VAP1 (AOC3) (NM_003734) Human Tagged ORF Clone Lentiviral Particle
RC208516L2V

USD 820.00

6 Weeks

Lenti ORF particles, AOC3 (mGFP-tagged) - Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
VAP1 (AOC3) (NM_003734) Human Tagged ORF Clone
RG208516

USD 460.00

In Stock

AOC3 (GFP-tagged) - Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AOC2 (NM_001158) Human Tagged ORF Clone
RG217318

USD 890.00

In Stock

AOC2 (GFP-tagged) - Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RG205320

USD 530.00

In Stock

MAOB (GFP-tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L3

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone Lentiviral Particle
RC205320L3V

USD 880.00

7 Weeks

Lenti ORF particles, MAOB (Myc-DDK tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L4

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone Lentiviral Particle
RC205320L4V

USD 880.00

5 Weeks

Lenti ORF particles, MAOB (mGFP-tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VAP1 (AOC3) (NM_003734) Human Tagged ORF Clone Lentiviral Particle
RC208516L3V

USD 820.00

5 Weeks

Lenti ORF particles, AOC3 (Myc-DDK tagged) - Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VAP1 (AOC3) (NM_003734) Human Tagged ORF Clone Lentiviral Particle
RC208516L4V

USD 820.00

3 Weeks

Lenti ORF particles, AOC3 (mGFP-tagged) - Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_001158) Human Tagged ORF Clone
RC217318L3

USD 1,010.00

3 Weeks

Lenti ORF clone of Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_001158) Human Tagged ORF Clone Lentiviral Particle
RC217318L3V

USD 1,210.00

6 Weeks

Lenti ORF particles, AOC2 (Myc-DDK tagged) - Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_001158) Human Tagged ORF Clone
RC217318L4

USD 1,010.00

3 Weeks

Lenti ORF clone of Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_001158) Human Tagged ORF Clone Lentiviral Particle
RC217318L4V

USD 1,210.00

6 Weeks

Lenti ORF particles, AOC2 (mGFP-tagged) - Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_009590) Human Tagged ORF Clone
RC222991L3

USD 620.00

3 Weeks

Lenti ORF clone of Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_009590) Human Tagged ORF Clone Lentiviral Particle
RC222991L3V

USD 820.00

6 Weeks

Lenti ORF particles, AOC2 (Myc-DDK tagged) - Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_009590) Human Tagged ORF Clone
RC222991L4

USD 620.00

3 Weeks

Lenti ORF clone of Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AOC2 (NM_009590) Human Tagged ORF Clone Lentiviral Particle
RC222991L4V

USD 820.00

6 Weeks

Lenti ORF particles, AOC2 (mGFP-tagged) - Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VAP1 (AOC3) (NM_001277732) Human Tagged ORF Clone
RC236665

USD 420.00

2 Weeks

AOC3 (myc-DDK-tagged) - Human amine oxidase, copper containing 3 (AOC3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
VAP1 (AOC3) (NM_001277731) Human Tagged ORF Clone
RC239164

USD 480.00

3 Weeks

AOC3 (myc-DDK-tagged) - Human amine oxidase, copper containing 3 (AOC3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sarcosine Oxidase (PIPOX) (NM_016518) Human Tagged ORF Clone
RG201274

USD 460.00

3 Weeks

PIPOX (GFP-tagged) - Human pipecolic acid oxidase (PIPOX)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AOC2 (NM_009590) Human Tagged ORF Clone
RG222991

USD 460.00

3 Weeks

AOC2 (GFP-tagged) - Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Over-expression Lysate
LY400321

USD 396.00

In Stock

Transient overexpression lysate of monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA327079

USD 275.00

2 Weeks

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB
Monoamine Oxidase B (MAOB) (NM_000898) Human Untagged Clone
SC108847

USD 310.00

In Stock

MAOB (untagged)-Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
VAP1 (AOC3) (NM_003734) Human Tagged ORF Clone
RC208516L1

USD 768.00

In Stock

Lenti ORF clone of Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
VAP1 (AOC3) (NM_003734) Human Tagged Lenti ORF Clone
RC208516L3

USD 768.00

3 Weeks

Lenti ORF clone of Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VAP1 (AOC3) (NM_003734) Human Recombinant Protein
TP723466

USD 240.00

2 Weeks

Purified recombinant protein of Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3).

Tag Tag Free
Expression Host CHO
VAP1 (AOC3) (NM_003734) Human Untagged Clone
SC303369

USD 760.00

In Stock

AOC3 (untagged)-Human amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
VAP1 (AOC3) (NM_003734) Human Over-expression Lysate
LY401227

USD 396.00

In Stock

Transient overexpression lysate of amine oxidase, copper containing 3 (vascular adhesion protein 1) (AOC3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AOC2 (NM_001158) Human Untagged Clone
SC302981

USD 1,470.00

In Stock

AOC2 (untagged)-Human amine oxidase, copper containing 2 (retina-specific) (AOC2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Monoamine Oxidase B (MAOB) Goat Polyclonal Antibody
TA318153

USD 425.00

In Stock

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).
VAP1 (AOC3) Rabbit Polyclonal Antibody
TA332495

USD 275.00

3 Weeks

Rabbit anti-AOC3 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOC3
Sarcosine Oxidase (PIPOX) Rabbit Polyclonal Antibody
TA344132

USD 475.00

5 Days

Rabbit Polyclonal Anti-PIPOX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIPOX antibody: synthetic peptide directed towards the C terminal of human PIPOX. Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG