Germany
Japan
United Kingdom
China
CYP3A7 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti-ORF clone of CYP3A7 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP3A7 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CYP3A7 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP3A7 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP3A7 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYP3A7 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYP3A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI |
Rabbit Polyclonal Anti-CYP3A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG |
CYP3A7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal Cytochrome P450 3A7 antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A7. |
Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of CYP3A7 (NM_000765) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A7 (NM_000765) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP3A7 (NM_000765) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP3A7
Families
- Transmembrane
Pathways
- Linoleic acid metabolism