CYP3A7 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP3A7 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CYP3A7 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A7 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CYP3A7 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A7 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP3A7 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CYP3A7 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYP3A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI |
Rabbit Polyclonal Anti-CYP3A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG |
CYP3A7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Cytochrome P450 3A7 antibody
Applications | WB |
Reactivities | Human |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A7. |
Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 7 (CYP3A7)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse monoclonal Anti-Cytochrome P450 3A7 Clone F19P2H2
Applications | IHC, WB |
Reactivities | Human |
Transient overexpression of CYP3A7 (NM_000765) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A7 (NM_000765) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP3A7 (NM_000765) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack