NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NCAM2 (GFP-tagged) - Human neural cell adhesion molecule 2 (NCAM2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NCAM2 (untagged)-Human neural cell adhesion molecule 2 (NCAM2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
NCAM2 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-NCAM2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NCAM2. |
Rabbit Polyclonal Anti-NCAM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NCAM2 antibody: synthetic peptide directed towards the middle region of human NCAM2. Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL |
Transient overexpression of NCAM2 (NM_004540) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NCAM2 (NM_004540) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NCAM2 (NM_004540) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack