Products

View as table Download

Rabbit polyclonal anti-EPHA6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA6.

Rabbit Polyclonal Anti-EPHA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA6. Synthetic peptide located within the following region: DTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTG

Carrier-free (BSA/glycerol-free) EPHA6 mouse monoclonal antibody,clone OTI5B9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EPHA6 mouse monoclonal antibody,clone OTI5B9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EPHA6 mouse monoclonal antibody,clone OTI5B9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated