Rabbit polyclonal anti-EPHA6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA6. |
Rabbit polyclonal anti-EPHA6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA6. |
Rabbit Polyclonal Anti-EPHA6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA6. Synthetic peptide located within the following region: DTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTG |
Carrier-free (BSA/glycerol-free) EPHA6 mouse monoclonal antibody,clone OTI5B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPHA6 mouse monoclonal antibody,clone OTI5B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EPHA6 mouse monoclonal antibody,clone OTI5B9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
EPHA6 mouse monoclonal antibody,clone OTI5B9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EPHA6 mouse monoclonal antibody,clone OTI5B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |