Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 33 of 33 results

(reset)

NPTN Rabbit Polyclonal Antibody

TA341913

USD 310.00

5 Days

Rabbit Polyclonal Anti-NPTN Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

1 / 2

2 / 2

Previous Next

NPTN Rabbit Polyclonal Antibody

TA312700

USD 345.00

4 Weeks

Rabbit polyclonal anti-NPTN antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human NPTN.

NPTN Rabbit Polyclonal Antibody

TA341912

USD 375.00

5 Days

Rabbit Polyclonal Anti-NPTN Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK

NPTN Mouse Monoclonal Antibody [Clone ID: OTI3C4]

CF504319

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2D4]

CF504330

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2A6]

CF504407

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2F4]

CF504435

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2F5]

CF504452

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI1E5]

CF504538

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI3C4]

TA504319

USD 379.00

In Stock

NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NPTN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C4]

TA504319AM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NPTN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C4]

TA504319BM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	HRP

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI3C4]

TA504319S

USD 159.00

2 Days

NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2D4]

TA504330

USD 379.00

In Stock

NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

NPTN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]

TA504330AM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

NPTN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]

TA504330BM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2D4]

TA504330S

USD 159.00

2 Days

NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2A6]

TA504407

USD 379.00

In Stock

NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A6]

TA504407AM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), Biotinylated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]

TA504407BM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), HRP conjugated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2A6]

TA504407S

USD 159.00

2 Days

NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2F4]

TA504435

USD 379.00

In Stock

NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F4]

TA504435AM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), Biotinylated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F4]

TA504435BM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), HRP conjugated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	HRP

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2F4]

TA504435S

USD 159.00

2 Days

NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2F5]

TA504452

USD 379.00

In Stock

NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]

TA504452AM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]

TA504452BM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI2F5]

TA504452S

USD 159.00

2 Days

NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI1E5]

TA504538

USD 379.00

In Stock

NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E5]

TA504538AM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), Biotinylated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E5]

TA504538BM

USD 420.00

4 Weeks

NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), HRP conjugated

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	HRP

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

NPTN Mouse Monoclonal Antibody [Clone ID: OTI1E5]

TA504538S

USD 159.00

2 Days

NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 33 of 33 results