Rabbit polyclonal anti-DGKE antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
Rabbit polyclonal anti-DGKE antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
DGKE rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-DGKE Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |