Products

cDNA Clones (10)
Antibodies (7)
Proteins (6)
Jump to Filters
View as table Download
Lass5 (CERS5) (NM_147190) Human Tagged ORF Clone
RC207649

USD 420.00

In Stock

CERS5 (Myc-DDK-tagged)-Human LAG1 homolog, ceramide synthase 5 (LASS5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lass5 (CERS5) (NM_147190) Human Untagged Clone
SC100282

USD 310.00

In Stock

CERS5 (untagged)-Human LAG1 homolog, ceramide synthase 5 (LASS5)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Lass5 (CERS5) (NM_001281731) Human Tagged ORF Clone
RC237517

USD 420.00

In Stock

CERS5 (myc-DDK-tagged) - Human ceramide synthase 5 (CERS5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lass5 (CERS5) (NM_147190) Human Tagged ORF Clone
RG207649

USD 460.00

In Stock

CERS5 (GFP-tagged) - Human LAG1 homolog, ceramide synthase 5 (LASS5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lass5 (CERS5) (NM_147190) Human Tagged ORF Clone
RC207649L3

USD 620.00

3 Weeks

Lenti-ORF clone of CERS5 (Myc-DDK-tagged)-Human LAG1 homolog, ceramide synthase 5 (LASS5)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lass5 (CERS5) (NM_147190) Human Tagged ORF Clone
RC207649L4

USD 620.00

3 Weeks

Lenti-ORF clone of CERS5 (mGFP-tagged)-Human LAG1 homolog, ceramide synthase 5 (LASS5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lass5 (CERS5) (C-term) Rabbit Polyclonal Antibody
AP22658PU-N

USD 440.00

2 Weeks

Lass5 (CERS5) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen LASS5 antibody was raised against lASS5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA306610

USD 430.00

5 Days

Rabbit Polyclonal LASS5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 18 amino acid peptide near the amino terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA331637

USD 375.00

5 Days

Rabbit Polyclonal Anti-LASS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LASS5 Antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: CALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRK
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA306609

USD 430.00

5 Days

Rabbit Polyclonal LASS5 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA306688

USD 430.00

5 Days

Rabbit Polyclonal LASS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 14 amino acid peptide near the amino terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA341466

USD 375.00

5 Days

Rabbit Polyclonal Anti-LASS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LASS5 antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR
Lass5 (CERS5) (NM_001281731) Human Tagged ORF Clone
RG237517

USD 460.00

2 Weeks

CERS5 (GFP-tagged) - Human ceramide synthase 5 (CERS5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lass5 (CERS5) (NM_001281731) Human Untagged Clone
SC335411

USD 340.00

2 Weeks

CERS5 (untagged) - Human ceramide synthase 5 (CERS5), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA351344

USD 345.00

In Stock

Rabbit Polyclonal Anti-CERS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CERS5
Lass5 (CERS5) (NM_147190) ICC Control Block
TB407649

USD 1,070.00

4 Weeks

Transient overexpression of CERS5 (NM_147190) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lass5 (CERS5) (NM_001281731) ICC Control Block
TB437517

USD 1,070.00

4 Weeks

Transient overexpression of CERS5 (NM_001281731) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lass5 (CERS5) Cytosection
TS407649

USD 225.00

4 Weeks

Transient overexpression of CERS5 (NM_147190) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Lass5 (CERS5) Cytosection
TS407649P5

USD 889.00

4 Weeks

Transient overexpression of CERS5 (NM_147190) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Lass5 (CERS5) Cytosection
TS437517

USD 225.00

4 Weeks

Transient overexpression of CERS5 (NM_001281731) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Lass5 (CERS5) Cytosection
TS437517P5

USD 889.00

4 Weeks

Transient overexpression of CERS5 (NM_001281731) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack