Germany
Japan
United Kingdom
China
CYP2E1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CYP2E1 (untagged)-Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 850.00
3 Weeks
Lenti ORF particles, CYP2E1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 850.00
6 Weeks
Lenti ORF particles, CYP2E1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYP2E1 (GFP-tagged) - Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 850.00
3 Weeks
Lenti ORF particles, CYP2E1 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 850.00
3 Weeks
Lenti ORF particles, CYP2E1 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal CYP2E1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Cytochrome P450 2E1 (CYP2E1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 405 of Human Cytochrome P450. |
Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of human P450ⅡE1 |
CYP2E1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 1,140.00
9 Weeks
Sheep polyclonal anti-Cytochrome P450 2E1 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYP 2E1 |
Rabbit polyclonal anti-Cytochrome P450 (CYP2E1) antibody
| Reactivities | Human, Rat |
| Immunogen | Cytochrome P450 (CYP2E1) |
CYP2E1 (29-493, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CYP2E1 (29-493, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
CYP2E1 MS Standard C13 and N15-labeled recombinant protein (NP_000764)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP2E1 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
In Stock
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Transient overexpression of CYP2E1 (NM_000773) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2E1 (NM_000773) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2E1 (NM_000773) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP2E1
Families
- Transmembrane