FZD10 (Myc-DDK-tagged)-Human frizzled family receptor 10 (FZD10)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FZD10 (Myc-DDK-tagged)-Human frizzled family receptor 10 (FZD10)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, FZD10 (Myc-DDK tagged) - Human frizzled family receptor 10 (FZD10), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, FZD10 (mGFP-tagged) - Human frizzled family receptor 10 (FZD10), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
FZD10 (GFP-tagged) - Human frizzled family receptor 10 (FZD10)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
FZD10 (untagged)-Human frizzled family receptor 10 (FZD10)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human frizzled family receptor 10 (FZD10), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, FZD10 (Myc-DDK tagged) - Human frizzled family receptor 10 (FZD10), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human frizzled family receptor 10 (FZD10), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, FZD10 (mGFP-tagged) - Human frizzled family receptor 10 (FZD10), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of frizzled homolog 10 (Drosophila) (FZD10)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal anti-FZD10 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
Rabbit Polyclonal Anti-FZD10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF |
Lenti ORF clone of Human frizzled family receptor 10 (FZD10), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
FZD10 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Frizzled-10 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 150-200 of human Frizzled-10 was used as the immunogen |
Anti-FZD10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 171-185 amino acids of human frizzled family receptor 10 |
FZD10 Antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH |
Transient overexpression of FZD10 (NM_007197) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FZD10 (NM_007197) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FZD10 (NM_007197) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack