Germany
Japan
United Kingdom
China
GPNMB (Myc-DDK-tagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
GPNMB (GFP-tagged) - Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, GPNMB (Myc-DDK tagged) - Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GPNMB (mGFP-tagged) - Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GPNMB (GFP-tagged) - Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPNMB (Myc-DDK tagged) - Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, GPNMB (mGFP-tagged) - Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPNMB (Myc-DDK-tagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GPNMB (Myc-DDK-tagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPNMB (Myc-DDK-tagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, GPNMB (mGFP-tagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPNMB (mGFP-tagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
GPNMB (untagged)-Homo sapiens, Similar to glycoprotein (transmembrane) nmb, clone MGC:1696 IMAGE:3345861, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GPNMB mouse monoclonal antibody, clone 3A5, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
GPNMB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GPNMB (untagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GPNMB (untagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN |
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE |
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV |
GPNMB / HGFIN (22-474, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
GPNMB / HGFIN (22-474, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI5C2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI7E3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody,clone OTI2E10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody,clone OTI2H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB MS Standard C13 and N15-labeled recombinant protein (NP_001005340)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- GPNMB
Families
- Transmembrane